Recombinant Ursus maritimus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant MT-ND4L

ParameterDetailsSource
SourceE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–98aa)
Purity>90% (SDS-PAGE verified)
Storage BufferTris-based buffer with 50% glycerol, optimized for stability
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, followed by affinity chromatography using the His-tag .

Workflow Overview

  1. Cloning: MT-ND4L gene amplified and inserted into an expression vector.

  2. Expression: Induced in E. coli under optimized conditions.

  3. Purification:

    • Step 1: Lysis and centrifugation to isolate inclusion bodies.

    • Step 2: Denaturation/renaturation or solubilization with detergents.

    • Step 3: Immobilized metal affinity chromatography (IMAC) for His-tag binding.

    • Step 4: Final polishing via size-exclusion chromatography .

Applications in Research

Recombinant MT-ND4L is primarily used in:

  • SDS-PAGE: To assess purity and confirm subunit size (~11 kDa) .

  • Biochemical Studies: To analyze Complex I subunit interactions or electron transfer dynamics .

  • Evolutionary Biology: To compare mitochondrial adaptations across Ursidae species .

Role in Mitochondrial Complex I

MT-ND4L is a core subunit of Complex I, facilitating electron transfer from NADH to ubiquinone and proton pumping across the inner mitochondrial membrane . Mutations in homologous human genes (e.g., MT-ND4L) are linked to Leber hereditary optic neuropathy (LHON) , though no such associations have been reported for Ursus maritimus.

Evolutionary Insights

Comparative studies of mitochondrial genomes in Ursus species highlight gene rearrangements and tandem repeats, which may influence Complex I assembly . Recombinant MT-ND4L enables functional studies to probe these structural variations .

Challenges in Mitogenome Assembly

In some species, mitochondrial DNA rearrangements (e.g., tandem repeats) complicate genome assembly. Tools like Numt Parser remove nuclear mitochondrial pseudogene (NUMT) contamination, improving accuracy in Ursidae mitogenome reconstruction .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To prevent degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Ursus maritimus (Polar bear) (Thalarctos maritimus)
Target Names
Target Protein Sequence
MPVVYVNIFLAFIVSLVGLLIYRSHLMSSLLCLEGMMLSLFVMLTVTVLNNHFTLANMAP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) is responsible for catalyzing electron transfer from NADH through the respiratory chain, using ubiquinone as the electron acceptor.
Database Links

KEGG: umr:804868

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the normal function of MT-ND4L in Ursus maritimus?

MT-ND4L gene provides instructions for making NADH dehydrogenase 4L protein, which forms part of Complex I in the mitochondrial electron transport chain. In Ursus maritimus, as in other mammals, this protein participates in oxidative phosphorylation – the process of converting energy from food into adenosine triphosphate (ATP). The protein is embedded in the inner mitochondrial membrane where it contributes to the first step of electron transport, transferring electrons from NADH to ubiquinone . This creates an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis, making MT-ND4L essential for energy production in tissues with high metabolic demands, including muscle and neural tissue during the polar bear's prolonged fasting periods and cold exposure.

How does MT-ND4L structure differ between Ursus maritimus and other mammals?

While the search results don't provide specific structural comparisons of MT-ND4L between polar bears and other mammals, research approaches would typically examine conservation of amino acid sequences across species. Researchers should:

  • Perform multiple sequence alignments of MT-ND4L using bioinformatics tools

  • Identify conserved domains versus polar bear-specific variations

  • Use structural prediction software to model potential functional implications

  • Examine codon usage bias that might reflect environmental adaptations

Such comparative analyses would likely reveal evolutionary adaptations related to the polar bear's extreme Arctic environment, potentially showing modifications that enhance mitochondrial efficiency during prolonged fasting and cold exposure conditions.

What techniques are recommended for isolating MT-ND4L from Ursus maritimus tissue samples?

For successful isolation of MT-ND4L from polar bear tissue samples, researchers should implement a multi-step protocol:

  • Tissue collection and preservation in RNA stabilization solution (RNAlater) immediately after sampling

  • Mitochondrial isolation using differential centrifugation techniques

  • Application of hemoglobin transcript depletion methods (such as Long-DASH) for blood samples to improve mitochondrial gene detection

  • RNA extraction followed by full-length cDNA synthesis

  • Use of Oxford Nanopore Technology (ONT) based R2C2 long-read approach in parallel with Illumina short-read sequencing for comprehensive transcriptome analysis

This approach has been successful in generating approximately 6,000 high-confidence isoforms from polar bear samples, allowing for accurate annotation of mitochondrial genes like MT-ND4L .

How do mutations in MT-ND4L affect mitochondrial function in comparative animal models?

Mutations in MT-ND4L can significantly impair mitochondrial function across species. In studied animal models, MT-ND4L mutations typically result in:

  • Reduced oxygen consumption rates, as demonstrated in mouse embryonic fibroblast (MEF) cell lines with MT-ND5 mutations, suggesting similar effects would be observed with MT-ND4L mutations

  • Compromised Complex I activity, measurable using the NADH-Ubiquinone Oxidoreductase method with an Aminco DW-2000 Spectrophotometer

  • Decreased ATP production capacity with downstream effects on tissues with high energy demands

  • Impaired thermogenesis, particularly evident during cold exposure challenges

A properly designed study would include oxygen consumption measurements comparing wild-type and mutant samples across temperature gradients particularly relevant to understanding polar bear metabolic adaptations. Researchers should utilize indirect calorimetry testing to assess metabolic capabilities, as was done in the MT-ND5 knockout study showing significant decreases in oxygen consumption and CO₂ production during certain activity cycles .

What methodological approaches are most effective for expressing recombinant Ursus maritimus MT-ND4L?

For optimal expression of recombinant Ursus maritimus MT-ND4L, researchers should consider a methodological pipeline that addresses the challenges of hydrophobic mitochondrial membrane protein expression:

  • Gene synthesis with codon optimization for the chosen expression system (typically E. coli, yeast, or mammalian cell lines)

  • Incorporation into vectors containing solubility-enhancing fusion partners (MBP, SUMO, or TrxA)

  • Establishment of controlled expression conditions, typically using lower temperatures (16-18°C) and reduced inducer concentrations

  • Membrane-mimetic environments for protein folding (detergents, nanodiscs, or liposomes)

  • Purification strategy using affinity chromatography followed by size exclusion chromatography

For functional studies, researchers should consider reconstituting the purified protein into liposomes capable of maintaining electrochemical gradients, allowing for measurements of electron transport activity in a controlled system.

How can heteroplasmy be assessed in MT-ND4L variants from wild Ursus maritimus populations?

Assessment of heteroplasmy (the presence of multiple mitochondrial DNA variants within an individual) in wild polar bear populations requires a sophisticated methodological approach:

  • Sample collection optimization (using minimally invasive techniques like hair or fecal samples for endangered populations)

  • DNA extraction protocols specifically optimized for mitochondrial DNA isolation

  • Deep sequencing approaches:

    • Next-generation sequencing with coverage depth >1000x

    • Single-molecule real-time sequencing for long-read analysis

    • Oxford Nanopore Technology for field-applicable sequencing

  • Computational analysis using specialized algorithms for detecting low-frequency variants (similar to approaches used in studies of MT-ND4 variants showing statistical significance with ORs of 0.67, 95% CI = 0.59 to 0.76)

Data analysis should include:

Analytical ApproachApplicationOutput Measure
Variant caller algorithmsDetection of heteroplasmic sitesFrequency of variant alleles
Haplotype phasingDetermining variant combinationsMitochondrial haplotype distribution
Population genetics toolsAssessing selection pressuresFixation index (FST), neutrality tests
Functional predictionImpact assessmentProtein structure/function changes

These approaches allow researchers to link heteroplasmic variants to potential functional adaptations in polar bear subpopulations across the Arctic region.

What controls are essential when studying recombinant Ursus maritimus MT-ND4L in laboratory settings?

When designing experiments with recombinant Ursus maritimus MT-ND4L, researchers must implement the following controls:

  • Species comparison controls:

    • Human MT-ND4L expression in parallel (well-characterized reference)

    • Other Arctic mammal MT-ND4L (comparative adaptation control)

    • Non-Arctic bear species MT-ND4L (phylogenetic control)

  • Experimental validation controls:

    • Empty vector controls for expression systems

    • Wild-type MT-ND4L alongside mutant versions

    • Enzymatically inactive mutants (negative controls)

    • Complex I activity measurements in native mitochondria (positive control)

  • Functional assessment controls:

    • Temperature gradient testing (4°C, 25°C, 37°C) to assess thermal stability

    • pH range testing to mimic physiological conditions during hibernation-like states

    • Oxygen concentration variations to simulate diverse tissue environments

These controls ensure that observed effects can be correctly attributed to the recombinant protein rather than experimental artifacts or system-specific responses.

How should researchers design experiments to compare MT-ND4L function across different bear species?

A comprehensive experimental design for cross-species MT-ND4L functional comparison should include:

  • Sample acquisition and processing:

    • Collection of tissue samples (preferably muscle or liver) from multiple bear species

    • Standardized RNA extraction and cDNA synthesis protocols

    • Application of Long-DASH hemoglobin depletion for blood samples

    • Full-length cDNA sequencing using Oxford Nanopore Technology's R2C2 approach

  • Expression and functional analysis:

    • Recombinant expression of each species' MT-ND4L under identical conditions

    • Complex I activity assays measuring NADH-ubiquinone oxidoreductase function

    • Oxygen consumption measurements at varying temperatures

    • Protein stability assessments under thermal and oxidative stress

  • Data analysis framework:

ParameterMeasurement MethodRelevance to Adaptation
Complex I activityNADH-Ubiquinone Oxidoreductase assayEnergy production efficiency
Oxygen consumptionClark electrode measurementsMetabolic rate differences
Protein stabilityThermal shift assaysAdaptation to environmental temperatures
ROS productionFluorescent probe quantificationOxidative stress management

This approach enables identification of species-specific adaptations in MT-ND4L function that may correlate with ecological niche and physiological demands.

How can researchers distinguish between pathogenic and adaptive mutations in Ursus maritimus MT-ND4L?

Distinguishing adaptive from pathogenic mutations in polar bear MT-ND4L requires an integrated analytical approach:

  • Population genomics analysis:

    • Survey MT-ND4L variants across multiple polar bear subpopulations

    • Compare allele frequencies between geographically distinct groups

    • Apply selection tests (dN/dS ratios, Tajima's D, McDonald-Kreitman test)

  • Functional impact assessment:

    • Express recombinant proteins with various mutations

    • Compare Complex I activity between variants

    • Measure oxygen consumption rates (similar to methodologies used in MT-ND5 studies showing significantly lower rates in mutant cells)

    • Assess protein stability and assembly into Complex I

  • Comparative genomics:

    • Align sequences with other bear species and Arctic mammals

    • Identify polar bear-specific substitutions

    • Map mutations onto protein structural models

Adaptive mutations would typically show: (1) signatures of positive selection, (2) maintained or enhanced function in cold environments, and (3) conservation within polar bear populations but divergence from other species. Pathogenic mutations would instead demonstrate decreased Complex I function and reduced cellular viability.

What statistical approaches are recommended for analyzing MT-ND4L heteroplasmy data from wild populations?

For robust statistical analysis of MT-ND4L heteroplasmy in wild polar bear populations, researchers should implement:

  • Detection and quantification methods:

    • Next-generation sequencing with minimum coverage depth >1000x

    • Error correction algorithms to distinguish true variants from sequencing errors

    • Establishment of detection thresholds based on technical replicates

  • Statistical framework:

    • Logistic regression testing for variant-phenotype associations (as used in studies showing significant associations with odds ratios of approximately 0.67, 95% CI = 0.59 to 0.76 for MT-ND4 variants)

    • Mixed-effects models accounting for familial relationships and population structure

    • Bayesian approaches for estimating heteroplasmy levels with confidence intervals

  • Population-level analyses:

    • AMOVA (Analysis of Molecular Variance) across subpopulations

    • Isolation-by-distance testing for geographical patterns

    • Correlation analyses with environmental variables (sea ice coverage, prey availability)

These approaches allow researchers to determine whether heteroplasmic variants represent neutral diversity, adaptive responses to local conditions, or potentially deleterious mutations affecting population fitness.

How can MT-ND4L research contribute to polar bear conservation efforts?

MT-ND4L research offers valuable insights for polar bear conservation:

  • Physiological adaptation monitoring:

    • MT-ND4L variants may indicate adaptive responses to changing Arctic conditions

    • Tracking changes in mitochondrial efficiency could serve as an early warning system for population stress

    • Assessments of metabolic function similar to those used in MT-ND5 studies measuring thermoregulation capabilities

  • Population health assessment:

    • Non-invasive sampling (hair, feces) can be used to monitor MT-ND4L heteroplasmy

    • Changes in heteroplasmy levels might indicate environmental stress

    • Functional variants could be linked to survival metrics in tracked individuals

  • Conservation management applications:

    • Identification of subpopulations with unique adaptive variants for prioritized protection

    • Development of molecular biomarkers for health assessment

    • Integration with transcriptomics approaches that have successfully identified novel genes in polar bears

Researchers should design longitudinal studies tracking MT-ND4L variants across generations in relation to environmental changes and survival metrics, providing actionable data for conservation management decisions.

What methodological approaches allow for minimally invasive sampling of MT-ND4L from wild Ursus maritimus populations?

For ethical and effective sampling of MT-ND4L from endangered wild polar bear populations:

  • Sample collection optimization:

    • Hair sampling from day beds or rubbing posts (contains follicles with mitochondria)

    • Fecal sampling with preservation buffers for DNA/RNA stability

    • Remote biopsy darting with specialized tissue collection systems

    • Utilization of samples collected during routine conservation monitoring

  • Molecular processing:

    • Optimized extraction protocols for low-quantity samples

    • Whole genome amplification techniques for limited material

    • Application of Long-DASH depletion methods for blood samples to enhance mitochondrial gene detection

    • Nanopore sequencing for field-applicable real-time analysis

  • Validation approaches:

    • Technical replicates to ensure reproducibility

    • Comparison with reference samples from captive individuals

    • Cross-validation using multiple sample types from the same individual

These approaches minimize stress to wild animals while providing researchers with sufficient material for investigating MT-ND4L variations across polar bear populations throughout their range.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.