Recombinant Ustilago hordei Pheromone receptor 1 (PRA1)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant PRA1 refers to the full-length pheromone receptor protein (UniProt ID: Q99063) expressed heterologously in Escherichia coli with an N-terminal His-tag for purification . Key specifications include:

PropertyDetails
Amino Acid Range1–359 (full-length)
Molecular Weight~40 kDa (calculated)
TagN-terminal 10× His-tag
Expression SystemE. coli-based in vitro system
Storage Conditions-20°C or -80°C in Tris-based buffer with 50% glycerol

The protein sequence begins with MLDHVTPFFALFACILVLFALGWHIRSRNVGT... and includes seven predicted transmembrane domains characteristic of G protein-coupled receptors (GPCRs) .

Functional Roles in Fungal Biology

PRA1 is essential for:

Pheromone Perception and Mating

  • Binds mating pheromones (e.g., Mfa2) to activate mitogen-activated protein kinase (MAPK) signaling .

  • Constitutively endocytosed to regulate signal duration; blocking endocytosis impairs pheromone response and cell fusion .

  • Pra1-GFP localization studies show plasma membrane accumulation and vesicular trafficking .

Pathogenic Development

  • Required for formation of infectious filaments (hyphae) during host penetration .

  • Solopathogenic U. hordei strains engineered with compatible Pra1 and bE/bW loci bypass mating requirements for virulence .

  • Interacts with Rheb GTPase to modulate TORC1 signaling, affecting fungal aggressiveness .

Pathogenesis Studies

  • Deletion or overexpression of Pra1 alters fungal virulence in barley .

  • Used to study cross-talk between mating signaling and stress responses (e.g., unfolded protein response) .

Protein Interaction Networks

  • Associates with Rok1 phosphatase to regulate MAPK Kpp2 phosphorylation .

  • Rheb GTPase mutations disrupt Pra1 localization, linking nutrient sensing to mating .

Biotechnological Tool

  • Recombinant PRA1 serves as an antigen for antibody production .

  • Fluorescently tagged variants (e.g., Pra1-GFP) enable live-cell imaging of receptor dynamics .

Key Research Findings

Recent studies highlight PRA1’s regulatory complexity:

Study FocusDiscoverySource
Endocytosis DependencePra1 internalization is critical for sustained pheromone signaling.
UPR Cross-TalkUnfolded protein response (UPR) inhibits Pra1-mediated MAPK signaling via Rok1.
Solopathogenic EngineeringPra1 compatibility enables single-strain infections in barley.
Environmental SensingRheb-TORC1 axis disrupts Pra1 localization under nutrient-rich conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly during production.
Synonyms
PRA1; Pheromone receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Ustilago hordei (Barley covered smut fungus)
Target Names
PRA1
Target Protein Sequence
MLDHVTPFFALFACILVLFALGWHIRSRNVGTITLSLYLFFGNLDNFVNSVAWWSTAEDK APGFCEVSIRLRHALYIAIPASNLVIARKLESIASTRQVRASASEHKKSIIIDLLISVGL PVLYVSLMIVNQTNRYGIIEQVGCWPFLSLSWVWVLLVAAPVLIVSFASAVYSVLAFRWF WIRRRQFQAVLASSASTLNKARYIRLLVLTAIDMLLFFPIYVGSVSDTIRGAITTSYVSW SYVHTGFSYIPQFSAEVMEMQPSFKARLILSRLVCPISAYIFFAMFGLGQEARQGYKHAV LKALVFCKLRKERQKPIQNHIVANIEVVTFQSRETSGGIDGSPHSEKFSINTPTKYEEA
Uniprot No.

Target Background

Function
This protein serves as the receptor for the A2 pheromone, a prenylated mating factor in Ustilago hordei.
Protein Families
G-protein coupled receptor 4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant PRA1?

Escherichia coli represents the primary expression system documented for the production of recombinant Ustilago hordei PRA1. Specifically, the full-length protein (amino acids 1-359) can be successfully expressed as a fusion protein with an N-terminal His-tag . When designing expression constructs, researchers should consider:

Expression SystemAdvantagesChallengesNotes
E. coliHigh yield, cost-effective, rapid growthPotential for improper folding of membrane proteinsDemonstrated success with PRA1
YeastPost-translational modifications, proper folding of eukaryotic proteinsLower yield than E. coliPotentially better for functional studies
Insect cellsComplex eukaryotic processing, suitable for GPCRsHigher cost, longer expression timeNot documented for PRA1 but common for GPCRs

For optimal expression in E. coli, codon optimization may be necessary given the differences in codon usage between E. coli and U. hordei. The recombinant protein is typically purified using affinity chromatography targeting the His-tag .

What are the optimal storage conditions for recombinant PRA1?

Based on documented protocols for recombinant PRA1, the following storage recommendations should be followed:

  • Upon receipt, briefly centrifuge the vial before opening to bring contents to the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%).

  • Aliquot the protein solution to minimize freeze-thaw cycles.

  • Store working aliquots at 4°C for up to one week.

  • For long-term storage, keep aliquots at -20°C or preferably -80°C .

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. The storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What role does PRA1 play in fungal mating and pathogenicity?

PRA1 serves as a critical component in the fungal mating process and subsequent pathogenic development in Ustilago species. The receptor functions in several key processes:

  • Pheromone Perception: PRA1 localizes to the plasma membrane where it recognizes and binds specific mating pheromones secreted by compatible mating partners .

  • Signal Transduction: Upon pheromone binding, PRA1 activates intracellular signaling cascades that lead to mating-specific gene expression and morphological changes.

  • Cell-Cell Fusion: The receptor is essential for the cell fusion process between compatible mating partners, a prerequisite for pathogenic development .

  • Pathogenic Development: Following cell fusion, the dikaryotic filament formed is capable of infecting the host plant. Impairment of PRA1 function results in reduced virulence .

Studies using temperature-sensitive mutants in the endosomal target SNARE Yup1 have demonstrated that endocytosis is essential for pheromone perception through PRA1. Blockage of the fusion of endocytic transport vesicles with early endosomes leads to accumulation of PRA1-carrying endocytic vesicles in the cytoplasm and depletion of the receptor from the membrane, impairing pheromone perception and conjugation hyphae formation .

How does endocytosis affect PRA1 function?

Endocytosis plays a crucial role in regulating PRA1 function and pheromone sensing in Ustilago species. Research has revealed several important aspects of this relationship:

These findings highlight the essential role of endocytosis in PRA1 function and demonstrate that proper receptor trafficking is crucial for the initial steps of pathogenic development in Ustilago species.

How does PRA1 compare between different Ustilago species?

Pheromone receptors show important similarities and differences across Ustilago species, reflecting their evolutionary relationships and specialized host adaptations:

SpeciesReceptor CharacteristicsGenomic OrganizationEvolutionary Relationship
U. hordeiPRA1: 359 aa, 7 transmembrane domainsBipolar mating system with a and b loci separated by ~500 kbForms cluster with U. bromivora
U. bromivoraUBRO_03901 (PRA1 ortholog)Bipolar mating system with a and b loci separated by 183 kbClosely related to U. hordei
U. maydisPra1 (similar function)Tetrapolar mating systemMore distantly related to U. hordei and U. bromivora

Phylogenetic analysis using one-to-one orthologous genes shows that U. bromivora and U. hordei form a distinct cluster, with U. maydis showing closer relationship to species of the Sporisorium genus than to other Ustilago species . This phylogenetic relationship is reflected in the organization of mating-type loci and pheromone receptor structures.

In U. bromivora, the a locus (containing pheromone/receptor genes) and b locus (containing bEast and bWest genes encoding putative homeodomain transcription factors) are separated by a 183 kb region highly enriched in transposable elements (39.85% compared to the genome average of 14.33%) . This organization resembles the bipolar mating system found in U. hordei, although the region between the a and b loci in U. hordei is larger at approximately 500 kb .

What methodologies are most effective for studying PRA1-ligand interactions?

Several complementary approaches can be employed to study PRA1-ligand interactions, each with distinct advantages:

  • Fluorescence-based assays: Using fluorescently tagged PRA1 (such as PRA1-GFP) allows visualization of receptor localization, internalization, and trafficking in response to ligand binding. This approach has been successfully used to demonstrate constitutive endocytosis of PRA1 .

  • Binding assays with purified recombinant protein: Recombinant PRA1, expressed with an N-terminal His-tag in E. coli and purified to >90% purity as determined by SDS-PAGE, can be used for in vitro binding studies with synthetic pheromones .

  • Mutational analysis: Targeted mutations in PRA1 can help identify residues critical for ligand binding, G-protein coupling, and endocytosis. Testing these mutants in vivo can reveal structure-function relationships.

  • Computational modeling: Given the characteristic seven transmembrane structure of GPCRs, homology modeling based on related receptors with known structures can predict ligand binding pockets and interaction interfaces.

  • Conditional expression systems: Temperature-sensitive mutants like those in the endosomal target SNARE Yup1 have proven valuable for studying PRA1 function in relation to endocytosis .

For researchers focusing on functional assays, monitoring downstream responses to receptor activation can provide indirect evidence of ligand binding. These responses include measuring pheromone-induced gene expression, formation of conjugation hyphae, and subsequent cell fusion events .

How do mutations in PRA1 affect fungal pathogenicity?

Mutations in PRA1 can significantly impact several stages of the fungal lifecycle that are essential for pathogenicity in Ustilago species:

  • Pheromone Perception: Studies using endocytosis-deficient mutants demonstrate that proper PRA1 function is essential for pheromone recognition. When receptor trafficking is compromised, cells show reduced sensitivity to pheromones despite an intact receptor .

  • Mating and Cell Fusion: Defects in PRA1 function impair the formation of conjugation hyphae and subsequent cell-cell fusion, critical steps in the pathogenic lifecycle. Even when signaling defects are rescued by overexpression of PRA1, cell fusion remains impaired in endocytosis mutants .

  • Spore Formation and Germination: In related species, proper functioning of the pheromone-receptor system is crucial for spore formation and germination. Studies in U. bromivora, a close relative of U. hordei, show that mating type biases after spore germination can be observed, suggesting complex relationships between pheromone receptor alleles and viability .

  • Host Colonization: While initial recognition and fusion events are severely affected by PRA1 dysfunction, subsequent plant colonization appears less dependent on continuous receptor function, suggesting that PRA1 is most critical during the early stages of infection .

The relationship between PRA1 and pathogenicity is complex and stage-specific. Research indicates that while PRA1-dependent processes like pheromone recognition and cell fusion are absolutely required for initiating pathogenic development, later stages of plant colonization may rely on different molecular mechanisms .

What are key considerations when working with recombinant PRA1 in research?

When designing experiments with recombinant Ustilago hordei PRA1, researchers should consider several important factors to ensure reliable and reproducible results:

  • Protein Stability and Storage:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% recommended)

    • Store in small aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

    • Keep working aliquots at 4°C for no more than one week

  • Buffer Composition:

    • Standard storage buffer: Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Experimental buffers may need optimization depending on the specific assay

  • Membrane Protein Handling:

    • As a seven-transmembrane protein, PRA1 may require detergents or lipid environments for maintaining native conformation

    • Consider using lipid nanodiscs or detergent micelles for functional studies

  • Expression System Limitations:

    • E. coli-expressed PRA1 may lack post-translational modifications present in native protein

    • For functional studies, expression in eukaryotic systems might better preserve activity

  • Functional Validation:

    • Confirm protein activity before experiments

    • Consider using computational predictions of structure to guide experimental design

  • Control Experiments:

    • Include appropriate positive and negative controls

    • For comparison studies with related receptors, ensure consistent experimental conditions

These considerations will help researchers optimize their experimental protocols when working with recombinant PRA1 and increase the likelihood of obtaining meaningful results.

How can functional assays be designed to study PRA1 activity?

Designing functional assays for PRA1 requires understanding its biological role in pheromone perception and signaling. Several approaches can be implemented:

  • Receptor Localization Assays:

    • Fluorescent tagging of PRA1 with GFP or similar reporters

    • Live-cell microscopy to track receptor localization and internalization

    • FRAP (Fluorescence Recovery After Photobleaching) to measure receptor dynamics

  • Signaling Pathway Activation:

    • Measuring downstream signaling events (e.g., MAP kinase activation)

    • Reporter gene constructs driven by pheromone-responsive promoters

    • Calcium flux measurements if G-protein coupling activates calcium signaling

  • Morphological Response Assays:

    • Quantifying formation of conjugation hyphae in response to pheromone

    • Measuring cell-cell fusion efficiency

    • Assessing filamentous growth and pathogenic development

  • Binding Assays:

    • Direct measurement of ligand binding using labeled pheromones

    • Competition assays with unlabeled ligands

    • Saturation binding to determine affinity constants

  • Genetic Complementation:

    • Expression of PRA1 in receptor-null mutants to rescue pheromone sensitivity

    • Cross-species complementation to test functional conservation

    • Domain swapping to identify functional regions

When designing these assays, it's important to include appropriate controls and to consider the limitations of each approach. For membrane proteins like PRA1, maintaining the native membrane environment or providing suitable substitutes (like detergent micelles or lipid nanodiscs) is crucial for preserving function in vitro.

What structural predictions can be made about PRA1 using bioinformatic approaches?

Bioinformatic analysis of PRA1 can provide valuable insights into its structure and function through various computational approaches:

While these computational approaches provide valuable starting points, they should be validated through experimental methods such as site-directed mutagenesis, binding assays, and structural studies. The combination of bioinformatic predictions and experimental validation offers the most comprehensive understanding of PRA1 structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.