Recombinant Ustilago maydis ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

  • Transmembrane helices: ATP6 contains five hydrophobic helices critical for proton translocation .

  • Conserved residues: Arginine (e.g., aR159 in humans) on helix H5 is vital for proton pathway integrity .

Biological Role

ATP6 collaborates with subunit 9 (c-ring) to transport protons across the mitochondrial inner membrane, driving ATP synthesis in the F<sub>1</sub> domain . Mutations in homologous human MT-ATP6 cause neurodegenerative disorders like Leigh syndrome due to impaired proton coupling .

Key Studies in Ustilago maydis

  1. ATP20 Gene Deletion:

    • Disrupts ATP synthase dimer stability.

    • Reduces mitochondrial ATP synthesis by ~50%.

    • Increases H<sub>2</sub>O<sub>2</sub> production, linking ATP6 dysfunction to oxidative stress .

  2. Inhibitor Protein Inh1:

    • Deletion of Inh1 elevates ATPase activity 4-fold but does not prevent dimerization, suggesting ATP6’s structural resilience .

  3. Peripheral Stalk Subunits:

    • Subunits like ATP20 stabilize ATP synthase dimers, impacting cristae morphology and bioenergetic efficiency .

Disease Modeling

  • Over 58 pathogenic mutations in human ATP6 homologs disrupt proton translocation or subunit assembly, causing disorders like NARP (Neuropathy, Ataxia, Retinitis Pigmentosa) .

  • Recombinant ATP6 enables mechanistic studies of these mutations using cryo-EM and functional assays .

Industrial Applications

  • Used in enzymology to probe ATP synthase inhibition by phytochemicals or synthetic drugs .

  • Serves as a template for engineering stress-tolerant fungal strains in biotechnology .

Comparative Analysis of ATP6 Homologs

OrganismSubunit RolePathogenic MutationsFunctional Defects
Ustilago maydisProton channel stabilityN/AROS overproduction, ATP deficiency
Homo sapiensPathogenic mutation hotspot (e.g., m.8993T>G)Leigh syndrome, NARPImpaired proton coupling, ROS accumulation
Saccharomyces cerevisiaeAssembly regulationatp6 null mutants non-viableFailed oxidative phosphorylation

Future Directions

  • Structural Dynamics: High-resolution cryo-EM studies to map ATP6’s conformational changes during proton translocation .

  • Therapeutic Screening: Use recombinant ATP6 to identify compounds restoring ATP synthase function in mitochondrial diseases .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, should you require a specific format, kindly indicate your preference in the order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributor for precise delivery estimates.
All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your usage.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development accordingly.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
7-254
Protein Length
Full Length of Mature Protein
Species
Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus)
Target Names
ATP6
Target Protein Sequence
SPLEQFEVTSLISLNLPVLGYINLSLTNLGLYTILTVYLVLALHIMGSNNKQLIPSRWSI ALESSFASVHGLVKSQIGAANEMYLPFIYSLFFFILIANLSGNVPYGFTVATSIMVSIGL SMTIFIGVTILGLRLHKVHFFSFFVPSGTPLGLVPLLVPIELISYLARAFSLGVRLFANV TAGHVLMKILAGFLAPLFTSTFIISVLTVLPFIIFTGIIGLEIAVSFIQAYVFCVLTCSY LKDAIDLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) catalyzes the production of ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During ATP synthesis, the catalytic domain of F(1) undergoes a rotary mechanism involving the central stalk subunits, coupled to proton translocation. ATP synthase subunit a is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does ATP synthase function in basidiomycete fungi like U. maydis?

In basidiomycete fungi like Ustilago maydis, ATP synthase functions through a complex mechanism of energy conversion. The process involves:

  • Formation of an electrochemical proton gradient across the inner mitochondrial membrane

  • Proton translocation through the FO portion (including subunit a)

  • Rotation of the c-ring coupled to the γ-stalk in the F1 region

  • Catalysis of ATP synthesis at the α-β interfaces in the F1 head

This process is reversible in F-type ATP synthases like those found in U. maydis, allowing both ATP synthesis and hydrolysis depending on cellular conditions . The transduction of the electrochemical proton gradient into ATP synthesis is performed by the F1FO-ATP synthase complex, while the reverse reaction (ATP hydrolysis) is typically prevented by regulatory subunits such as Inh1 .

What expression systems are effective for producing recombinant U. maydis ATP6?

Recombinant U. maydis ATP6 can be effectively produced using E. coli expression systems. Based on available data, the full-length mature protein (amino acids 7-254) can be successfully expressed in E. coli with an N-terminal His tag . This approach allows for:

  • High-yield protein production

  • Simplified purification using affinity chromatography

  • Structural and functional studies of the isolated protein

When designing expression systems, researchers should consider codon optimization for E. coli and the addition of appropriate fusion tags to enhance solubility and facilitate purification .

What are the optimal conditions for purification and storage of recombinant ATP6?

Optimal purification and storage conditions for recombinant U. maydis ATP6 include:

ParameterRecommended ConditionNotes
Purification MethodAffinity chromatography (His-tag)>90% purity achievable by SDS-PAGE
Buffer CompositionTris/PBS-based bufferWith 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water0.1-1.0 mg/mL concentration
Short-term Storage4°CUp to one week for working aliquots
Long-term Storage-20°C/-80°CWith 5-50% glycerol (50% recommended)
Handling PrecautionsAvoid repeated freeze-thaw cyclesAliquoting necessary for multiple use

For optimal results, vials containing lyophilized protein should be briefly centrifuged prior to opening to bring contents to the bottom . Proper storage and handling are critical as repeated freezing and thawing can lead to protein denaturation and loss of activity.

How can researchers assess the impact of ATP6 mutations on ATP synthase function?

Assessing the impact of ATP6 mutations requires multiple complementary approaches:

  • Sequence Analysis: Compare mutated sequences with reference sequences using multiple sequence alignment tools like MUSCLE. This allows identification of significant alterations, such as truncations or substitutions in conserved regions .

  • Functional Assays: Measure ATPase activity in both directions using kinetic analysis:

    • ATP synthesis rates using permeabilized mitochondria

    • ATP hydrolysis (reverse reaction) with isolated enzyme complexes

    • Determination of kinetic parameters (Vmax and KM) under various pH conditions

  • Biophysical Measurements:

    • Membrane potential analysis

    • Oxygen consumption measurements

    • Proton translocation assays

  • Structural Integrity Assessment:

    • Analysis of complex assembly using blue native PAGE

    • Examination of oligomeric states (monomeric, dimeric, and multimeric forms)

When analyzing mutations, researchers should compare results with wild-type strains under identical conditions to accurately determine the functional consequences of the mutation .

What techniques can reveal ATP6 interactions with other ATP synthase subunits?

Several advanced techniques can be employed to study ATP6 interactions:

  • Crosslinking Studies: Chemical crosslinking followed by mass spectrometry can identify direct protein-protein interactions between ATP6 and other subunits.

  • Co-immunoprecipitation: Using antibodies against ATP6 or other subunits to pull down interaction partners.

  • Blue Native PAGE: Analysis of intact ATP synthase complexes can reveal the role of ATP6 in complex assembly and stability.

  • Mutational Analysis: Systematic mutations of interacting regions can identify critical residues for subunit interactions.

  • Cryo-EM and Structural Studies: High-resolution structural analysis of the entire ATP synthase complex can map the position and interactions of ATP6 .

Evidence from knockout studies of related proteins (such as Inh1) in U. maydis shows that these approaches can successfully identify functional interactions. For example, studies have revealed that Inh1 is not essential for the dimeric state of complex V, suggesting other subunits, potentially including ATP6, play more critical roles in complex assembly .

How conserved is ATP6 across related fungal species?

ATP6 shows significant conservation across related fungal species, but with important variations that may reflect functional adaptations. Comparative studies between Ustilago maydis and related species reveal:

  • Sequence Conservation Patterns:

    • Core functional domains show higher conservation

    • Membrane-spanning regions typically display greater conservation than loop regions

    • C-terminal regions may show more variation than N-terminal regions

  • Evolutionary Relationships:
    Mitochondrial genes like ATP6 can be used for phylogenetic analysis among smut fungi and other basidiomycetes. For example, MUSCLE analysis of related mitochondrial genes (like nad6) across U. maydis, U. bromivora, and S. reilianum has revealed significant sequence similarities as well as species-specific variations .

  • Functional Implications:
    The analysis of conserved regions can help identify critical amino acids necessary for function. Mutations in these regions are likely to have significant functional consequences, as seen in comparative studies of mitochondrial gene mutations .

What can mitogenomic analysis tell us about ATP6 evolution in Ustilago maydis?

Mitogenomic analysis provides valuable insights into ATP6 evolution:

  • Strain Variations: Different strains of U. maydis may contain polymorphisms or deletions in mitochondrial genes, reflecting evolutionary adaptations to different environments .

  • Geographical Patterns: Strains from different geographical origins (e.g., Chinese vs. German strains) can exhibit distinctive mitochondrial genetic patterns, including large-scale deletions or insertions that may affect ATP6 and other mitochondrial genes .

  • Selection Pressures: Analysis of synonymous vs. non-synonymous substitutions can reveal whether ATP6 is under purifying selection, positive selection, or neutral evolution.

  • Introgression Events: Mitogenomic analysis can identify potential hybridization or introgression events between related species that may have contributed to ATP6 evolution.

These analyses typically require whole genome sequencing (WGS) approaches, followed by PCR confirmation of identified polymorphisms, as demonstrated in studies of mitochondrial variation in related fungal species .

What protocols are most effective for analyzing ATP6 function in mitochondrial preparations?

Effective protocols for analyzing ATP6 function in mitochondrial preparations include:

  • Mitochondrial Isolation:

    • Mechanical cell disruption through glass bead homogenization

    • Differential centrifugation for mitochondrial enrichment

    • Sucrose gradient purification for higher purity preparations

  • Membrane Potential Analysis:

    • Fluorescent probes (e.g., JC-1, TMRM) to measure membrane potential

    • Real-time monitoring of potential changes during ATP synthesis/hydrolysis

  • ATP Synthesis/Hydrolysis Assays:

    • Luciferin-luciferase assays for real-time ATP measurement

    • Spectrophotometric assays coupling ATP hydrolysis to NADH oxidation

    • Kinetic analysis to determine Vmax and KM values

  • Oxygen Consumption Measurements:

    • Clark electrode or Seahorse technology to measure respiratory capacity

    • Assessment of coupling efficiency and proton leak

  • Complex V Activity Analysis:

    • In-gel activity assays following blue native PAGE

    • Comparison of monomeric vs. dimeric forms

    • Effects of detergents (e.g., dodecyl-maltoside) on activity

For optimal results, researchers should perform these analyses on both wild-type and experimentally modified strains under identical conditions. This approach has proven effective in studies of ATP synthase regulatory subunits in U. maydis .

How can researchers assess the impact of ATP6 modifications on cellular bioenergetics?

To assess the impact of ATP6 modifications on cellular bioenergetics, researchers can implement a multi-level analysis approach:

  • Cellular Growth Parameters:

    • Growth rate curves in different carbon sources

    • Glucose consumption measurements

    • Biomass production quantification

  • Mitochondrial Structure Analysis:

    • Ultrastructure examination via electron microscopy

    • Fluorescence analysis of mitochondrial networks

    • Cristae architecture assessment

  • Bioenergetic Parameters:

    • Membrane potential measurements

    • ATP synthesis rates

    • Oxygen consumption analysis

    • Proton motive force determination

  • ATP Synthase Complex Structure:

    • Analysis of complex assembly states (monomers, dimers, oligomers)

    • Effects of detergents on complex stability and activity

    • Kinetic analysis of ATPase activity in different pH conditions

  • Stress Response Assessment:

    • Performance under oxidative stress conditions

    • Adaptation to different carbon sources

    • Response to mitochondrial inhibitors

This comprehensive approach can reveal both direct effects on ATP synthase function and broader cellular adaptations to ATP6 modifications. Studies on related ATP synthase components in U. maydis have shown that cellular bioenergetics analysis can effectively distinguish between mutations that affect ATP synthase assembly versus those that primarily impact its catalytic function .

What are common challenges in recombinant ATP6 expression and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant ATP6:

ChallengePossible CausesSolutions
Low expression yieldProtein toxicity, codon bias, formation of inclusion bodiesOptimize codon usage, use weaker promoters, lower induction temperature, express as fusion protein
Protein insolubilityHydrophobic nature of membrane protein, improper foldingAdd detergents, use membrane-mimetic systems, express with solubility-enhancing tags
Purification difficultiesMultiple aggregation states, co-purifying contaminantsOptimize detergent choice, use multiple purification steps, consider on-column refolding
Loss of activityDenaturation during purification, absence of lipid environmentMaintain native-like environment with appropriate lipids, avoid harsh purification conditions
Storage instabilityProtein aggregation, proteolytic degradationAdd stabilizing agents (e.g., trehalose), store at appropriate temperature, avoid freeze-thaw cycles

For hydrophobic membrane proteins like ATP6, expression as a His-tagged fusion protein in E. coli has proven successful . Additional considerations include expressing the protein at lower temperatures (16-25°C) to reduce inclusion body formation and using specialized E. coli strains designed for membrane protein expression.

How can recombinant U. maydis ATP6 be utilized in inhibitor screening and drug development studies?

Recombinant U. maydis ATP6 can serve as a valuable tool for inhibitor screening and drug development:

  • High-throughput Screening Platforms:

    • Purified recombinant ATP6 can be incorporated into liposomes or nanodiscs

    • Fluorescence-based assays can monitor proton translocation activity

    • ATP synthesis/hydrolysis coupled assays can detect inhibitory effects

  • Structure-based Drug Design:

    • The resolved structure of ATP6 can guide rational design of inhibitors

    • Molecular docking studies can identify potential binding sites

    • Site-directed mutagenesis can validate predicted binding interactions

  • Antifungal Development:

    • Targeting fungal-specific features of ATP6 could lead to selective antifungals

    • Comparative studies between human and fungal ATP6 can identify selective targets

    • ATP synthase inhibitors represent a potentially novel class of antifungal compounds

  • Resistance Mechanism Studies:

    • Recombinant expression allows creation of mutant variants found in resistant strains

    • Functional characterization can reveal molecular mechanisms of resistance

    • Combinatorial approaches targeting multiple ATP synthase subunits can be explored

The ability to produce highly pure recombinant ATP6 (>90% as determined by SDS-PAGE) provides an excellent starting point for these applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.