Recombinant Ustilago maydis NADH-cytochrome b5 reductase 1 (CBR1)

Shipped with Ice Packs
In Stock

Description

Introduction

Ustilago maydis is a biotrophic fungus known for causing corn smut disease in maize . This fungus has also been recognized for its potential in biotechnology, particularly in the production of recombinant proteins . Recombinant Ustilago maydis NADH-cytochrome b5 reductase 1 (CBR1) is an enzyme that plays a role in various cellular processes, including fatty acid metabolism and detoxification .

Role in Recombinant Protein Production

Ustilago maydis is used as a host for producing recombinant proteins because it offers several advantages, including efficient protein secretion . The use of carrier proteins such as chitinase Cts1 and Jps1 facilitates the export of heterologous proteins without N-glycosylation . Jps1, in particular, has shown promise as an alternative carrier, enabling the efficient export of functional proteins like firefly luciferase and bi-specific synthetic nanobodies against the SARS-CoV2 spike protein .

Involvement in Fungal Virulence and Stress Response

The Unfolded Protein Response (UPR) regulator Cib1, a homolog of Hac1, plays a crucial role in the virulence of Ustilago maydis . Deletion of the UPRE in pit2 significantly affected virulence, demonstrating the importance of UPR-dependent regulation in pathogenicity . The UPR is also connected to regulatory pathways that control pathogenic development, where Cib1 expression leads to the stabilization of Clp1, promoting fungal proliferation in the host plant .

CBR1 in DNA Repair and Genome Stability

The BRCA2-interacting protein DSS1 is vital for DNA repair and genome stability in Ustilago maydis . Mutants of U. maydis deleted of DSS1 are extremely radiation sensitive, deficient in recombination, defective in meiosis, and disturbed in genome stability .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us; we will prioritize its inclusion in production.
Synonyms
CBR1; UMAG_00646; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus)
Target Names
CBR1
Target Protein Sequence
MVLIEQVVLVASILITFGTCLAATKYAARLFPHFEPLQFYDEATNPMELNIVLAFVVGLI GSVVVLLYFDSQKIKPVLNPTQWQQYRLMEKQKLSDNTALYRFKLPRSNNILGLPIGQHI SVQANMGGKTVVRSYTPTSSDDDHGFFDLVVKSYEQGNVSKYIGSMKIGDLLSVKGPKGQ MRYAPGLSRHIGMIAGGTGLTPCLQIIRAALKNPADKTQIDFIYANVKETDILLKDELDE LALKHKDQFRISYFLNEAPEGWKGGVGFVTKEALEKNLPKPANDIKVLMCGPPPMIKAMT GHLEALGYEKPRTVSKLEDQVFCF
Uniprot No.

Target Background

Function
Recombinant Ustilago maydis NADH-cytochrome b5 reductase 1 (CBR1) functions as an electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system is crucial for the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the enzymatic function of NADH-cytochrome b5 reductase 1 in Ustilago maydis?

NADH-cytochrome b5 reductase 1 (CBR1) in Ustilago maydis functions as a flavoprotein that catalyzes the transfer of electrons from the two-electron carrier NADH to the one-electron carrier cytochrome b5. This enzyme contains flavin adenine dinucleotide (FAD) as a prosthetic group and converts ferricytochrome b5 (Fe³⁺) to ferrocytochrome b5 (Fe²⁺) .

The reaction can be represented as:
NADH + 2 ferricytochrome b5 → NAD⁺ + 2 ferrocytochrome b5

In U. maydis, CBR1 plays crucial roles in multiple cellular processes, including:

  • Fatty acid metabolism

  • Sterol biosynthesis

  • Maintaining redox balance

  • Supporting morphological development and pathogenicity

Research using deletion mutants in related fungi has demonstrated that CBR1 significantly impacts fungal growth, sporulation, and virulence .

What are the key structural domains in U. maydis CBR1 and their functions?

U. maydis CBR1 contains several distinct functional domains typical of NADH-cytochrome b5 reductases:

  • N-terminal membrane-anchoring domain (residues 1-30): Contains hydrophobic residues that facilitate integration into the endoplasmic reticulum membrane. This domain contains the sequence "MVLIEQVVLVASILITFGTCLAA" which forms a transmembrane helix .

  • FAD-binding domain (residues ~50-170): Contains the consensus sequence for FAD binding. This domain is critical for accepting electrons from NADH and is characterized by a βαβ-fold structure. Mutations in this region severely compromise enzymatic activity .

  • NADH-binding domain (residues ~180-300): Contains the binding site for NADH with the characteristic Rossmann fold. This domain includes key residues that interact with the nicotinamide ring of NADH .

  • Catalytic residues: Include conserved amino acids such as threonine residues that facilitate electron transfer. In related b5 reductases, Thr66 creates hydrogen bonds with the N5 atom of the isoalloxazine ring of FAD, critical for the release of protons during catalysis .

Studies with other fungal b5 reductases indicate that slight conformational shifts between oxidized and reduced forms increase the solvent-accessible surface area of FAD, which is essential for electron transfer .

What expression systems are most effective for producing recombinant U. maydis CBR1 protein?

For producing functional recombinant U. maydis CBR1 protein, several expression systems have been successfully employed:

  • E. coli expression system: The most commonly used system due to its high yield and relatively simple protocols. For optimal expression:

    • Use BL21(DE3) strain for tightly controlled expression

    • Express as an N-terminal His-tagged fusion protein for easier purification

    • Culture at lower temperatures (16-20°C) after induction to enhance proper folding

    • Supplement growth media with riboflavin (10 μM) to support FAD incorporation

  • Yeast expression systems: Can provide better post-translational modifications:

    • Pichia pastoris offers advantages for membrane-associated proteins

    • Use constitutive promoters (like GAP) rather than inducible ones for steady expression

The choice between full-length CBR1 (including membrane domain) versus truncated soluble form depends on experimental goals:

FormAdvantagesLimitationsBest Expression System
Full-lengthNative function, membrane studiesLower solubilityPichia pastoris
Truncated (soluble)Higher yield, easier purificationMay lack some interactionsE. coli

Purification typically employs immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to achieve >90% purity .

What assays can be used to measure the enzymatic activity of recombinant U. maydis CBR1?

Several established assays can effectively measure the enzymatic activity of recombinant U. maydis CBR1:

  • Cytochrome b5 reduction assay:

    • Principle: Monitors the reduction of cytochrome b5 spectrophotometrically

    • Method: Mix purified CBR1 with cytochrome b5 and NADH in appropriate buffer

    • Measurement: Track absorbance increase at 424 nm (specific for reduced cytochrome b5)

    • Quantification: Calculate reaction rate using the extinction coefficient (ε = 100 mM⁻¹cm⁻¹)

  • Ferricyanide reduction assay:

    • Principle: Measures the reduction of potassium ferricyanide (artificial electron acceptor)

    • Method: Combine CBR1, NADH, and potassium ferricyanide in buffer

    • Measurement: Monitor decrease in absorbance at 420 nm

    • Advantages: Higher throughput and stability compared to cytochrome b5 assay

  • Hydroxylamine reduction assay:

    • Particularly relevant for studying drug metabolism applications

    • Example: Sulfamethoxazole hydroxylamine (SMX-HA) reduction can be measured

    • Typical parameters observed in related systems: Km range of 20-100 μM, with activities ranging from 0.06-1.11 nmol/min/mg protein

Standard reaction conditions typically include:

  • pH 7.4-7.6 (phosphate or Tris buffer)

  • Temperature: 25-37°C

  • NADH concentration: 50-200 μM

  • Protein concentration: 0.1-0.5 μg/ml

Controls should include reactions without NADH and heat-inactivated enzyme samples .

How should recombinant U. maydis CBR1 protein be properly stored and handled for maximum stability?

To maintain optimal stability and activity of recombinant U. maydis CBR1 protein:

Storage recommendations:

  • Store at -20°C/-80°C for extended storage

  • Use storage buffer containing Tris-based buffer with 50% glycerol, pH 8.0

  • Aliquot into small volumes to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Handling protocols:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • For working solutions, add glycerol to 5-50% final concentration

  • Avoid repeated freeze-thaw cycles as they significantly reduce enzyme activity

Stability considerations:

  • The enzyme contains FAD as a prosthetic group that can be lost during purification

  • Activity may decline over time due to oxidation of critical residues

  • Addition of reducing agents (0.1-1 mM DTT or 2-mercaptoethanol) in the storage buffer can help maintain activity

  • The enzyme is relatively stable at neutral pH (6.5-8.0) but rapidly loses activity under acidic conditions

How does CBR1 contribute to U. maydis pathogenicity and plant infection?

CBR1 plays multifaceted roles in U. maydis pathogenicity, as demonstrated by comparative studies with related fungi:

  • Support for morphological transitions: U. maydis alternates between a yeast-like form and filamentous form during its life cycle. CBR1 is essential for maintaining proper cell morphology during these transitions, which are critical for host invasion .

  • Oxidative stress response: During plant infection, U. maydis faces oxidative bursts from plant defense systems. CBR1 contributes to oxidative stress tolerance by:

    • Supporting antioxidant systems

    • Maintaining redox balance

    • Potentially interacting with peroxidases and cytochrome P450 systems

  • Lipid and sterol metabolism: CBR1 is essential for synthesis of membrane components needed during rapid hyphal growth in plant tissues:

    • Studies in related fungi show that CBR1 deletion leads to aberrant hyphal growth

    • Defects in spore morphology and reduced sporulation

    • Compromised ability to utilize plant sterols like β-sitosterol

  • Metabolic adaptation during infection: CBR1 activity supports metabolic shifts required during different infection stages:

    • Higher expression during specific infection phases

    • Contribution to specialized infection structures

    • Possible involvement in suppressing host defenses

Functional studies in the wheat pathogen Zymoseptoria tritici have shown that CBR1 deletion results in:

  • Delayed disease symptom development

  • Severely limited asexual sporulation

  • Aberrant spore morphology and hyphal growth in vitro

These findings suggest similar critical roles for CBR1 in U. maydis pathogenicity.

What metabolic pathways are dependent on CBR1 function in U. maydis?

CBR1 functions as a crucial electron donor in several essential metabolic pathways in U. maydis:

  • Fatty acid metabolism:

    • Provides electrons for fatty acid desaturation reactions

    • Supports elongation of fatty acid chains

    • Contributes to synthesis of specialized lipids needed during infection

  • Sterol biosynthesis:

    • Essential for multiple steps in ergosterol biosynthesis pathway

    • May serve as an electron donor for cytochrome P450 enzymes involved in sterol modification

    • Crucial for utilization of host plant sterols like β-sitosterol, which U. maydis cannot synthesize independently but uses for growth

  • Redox homeostasis:

    • Maintains cellular redox balance under stress conditions

    • Supports detoxification of reactive oxygen species

    • Contributes to NADH recycling mechanisms

  • Drug and xenobiotic metabolism:

    • Involved in reduction of hydroxylamine compounds

    • Participates in detoxification pathways for environmental toxins

    • Contributes to fungicide tolerance mechanisms

Research with related fungi has demonstrated that deletion of CBR1 results in:

Metabolic PathwayObserved Effects of CBR1 Deletion
Fatty acid profileAltered saturation levels, abnormal fatty acid ratios
Sterol contentReduced ergosterol levels, altered sterol intermediates
Sphingolipid productionDysregulation of sphingolipid synthesis
Stress responseIncreased sensitivity to oxidative, osmotic, and cell wall stress

These effects collectively contribute to the reduced pathogenicity, morphological abnormalities, and growth defects observed in CBR1-deficient fungi .

How does CBR1 function relate to oxidative stress responses in U. maydis?

CBR1 plays significant roles in U. maydis oxidative stress response networks:

  • Direct antioxidant support:

    • Provides reducing equivalents for multiple antioxidant systems

    • May directly interact with peroxidases to modulate their activity

    • Supports regeneration of oxidized cellular components

  • Regulation of oxidative stress response genes:

    • Studies in related systems show that CBR1 deletion affects expression of:

      • Peroxidase genes

      • Cytochrome P450 genes

      • Laccase genes

    • These effects suggest CBR1 may directly or indirectly influence stress-responsive transcriptional networks

  • Protection during plant infection:

    • Plants produce reactive oxygen species (ROS) as defense mechanisms

    • U. maydis must counteract this oxidative burst to establish infection

    • CBR1 likely contributes to tolerating host-derived oxidative stress

  • Interaction with specialized pathogenicity factors:

    • U. maydis secretes effectors like Pep1 that inhibit plant peroxidases

    • CBR1 may support these systems through maintenance of proper redox balance

    • Potential synergistic relationships with effector-mediated suppression of host defenses

Experimental evidence from a cytochrome b5-like protein (PlCB5L1) in the oomycete pathogen Peronophythora litchii provides insights into potential mechanisms:

Stress ConditionWild-type ResponseCB5-deficient PhenotypeMolecular Mechanism
H₂O₂ exposureNormal growthImpaired toleranceReduced peroxidase activity
Cell wall stressNormal growthIncreased sensitivityAltered cell wall composition
Osmotic stressNormal growthImpaired toleranceMembrane lipid alterations

The study demonstrated that deletion of this cytochrome b5-like gene led to downregulation of peroxidase, cytochrome P450, and laccase genes under oxidative stress conditions , suggesting similar mechanisms may operate in U. maydis.

What techniques can be used to study protein-protein interactions involving U. maydis CBR1?

Multiple complementary techniques can be employed to investigate protein-protein interactions involving U. maydis CBR1:

  • Yeast two-hybrid (Y2H) screening:

    • Use soluble domains of CBR1 as bait against U. maydis cDNA library

    • Modified membrane Y2H systems can accommodate the membrane-anchored form

    • Verification of interactions through directed Y2H with specific candidates

  • Co-immunoprecipitation (Co-IP):

    • Generate epitope-tagged CBR1 constructs (e.g., FLAG, HA, or His-tag)

    • Express in U. maydis or heterologous systems

    • Pull-down experiments to identify interacting partners

    • Western blot or mass spectrometry to identify co-precipitated proteins

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein (e.g., YFP) fused to CBR1 and potential interactors

    • In vivo visualization of interactions in U. maydis cells

    • Particularly effective for membrane-associated protein interactions

    • Example from related research: Interaction between maize peroxidase POX12 and fungal effector Pep1 was confirmed using this approach

  • Förster Resonance Energy Transfer (FRET):

    • Tag CBR1 and potential partners with appropriate fluorophore pairs

    • Measure energy transfer as indication of protein proximity

    • Can be combined with microscopy for spatial information

  • Crosslinking Mass Spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest and analyze by mass spectrometry

    • Identifies not only partners but interaction interfaces

Expected interaction partners to investigate include:

  • Cytochrome b5

  • Cytochrome P450 family members

  • Components of the endoplasmic reticulum

  • Proteins involved in sterol and fatty acid metabolism

  • Potential regulatory proteins

Research with other fungal systems suggests that CBR1 interactions may change during different developmental stages and under stress conditions .

How can site-directed mutagenesis of U. maydis CBR1 reveal structure-function relationships?

Site-directed mutagenesis of U. maydis CBR1 can systematically elucidate structure-function relationships:

Key residues/regions for targeted mutagenesis:

  • FAD binding domain:

    • Conserved residues coordinating FAD (based on crystal structures of related b5 reductases)

    • Mutations in these residues should disrupt electron acceptance from NADH

    • Example: The N5 atom of the isoalloxazine ring of FAD creates hydrogen bonds with Thr66 in porcine b5 reductase, essential for proton release

  • NADH binding motifs:

    • Glycine-rich regions characteristic of Rossmann folds

    • Residues contacting the nicotinamide ring

    • Mutations here would affect NADH binding and electron transfer

  • Membrane anchoring domain:

    • Hydrophobic residues in the N-terminal region

    • Mutations can test subcellular localization requirements

    • Truncation studies can determine if soluble forms retain specific functions

  • Cytochrome b5 interaction interface:

    • Residues involved in electron transfer to cytochrome b5

    • Potential interface for protein-protein interactions

Experimental approach:

  • Create a library of point mutations using PCR-based methods

  • Express mutant proteins in E. coli or U. maydis

  • Assess functional consequences through:

    • Enzymatic activity assays (NADH oxidation, cytochrome b5 reduction)

    • Protein stability analyses (thermal shift assays, limited proteolysis)

    • Binding affinity measurements (isothermal titration calorimetry)

    • Complementation studies in CBR1 deletion strains

    • Phenotypic analysis of mutant strains

Example experimental design:

Mutation TargetPredicted EffectAssays to Test Function
FAD binding residuesReduced catalytic activityEnzyme kinetics, FAD binding
NADH binding residuesAltered NADH affinityKm determination, NADH binding
Membrane anchorAltered subcellular localizationMicroscopy, fractionation
Interface residuesSpecific disruption of protein interactionsPull-down assays, BiFC

Previous studies with CBR gene family members in Zymoseptoria tritici and in human CBR polymorphisms (R59H and R297H) have shown that specific mutations can cause atypical hydroxylamine reduction kinetics and decreased reduction efficiency .

How can U. maydis CBR1 function be studied in the context of the host-pathogen interaction?

Studying U. maydis CBR1 function during maize infection requires specialized approaches that integrate molecular, cellular, and whole-organism methodologies:

  • Generation of modified CBR1 strains:

    • CRISPR/Cas9-mediated gene deletion (Δcbr1)

    • Complementation with wild-type or mutant alleles

    • Fluorescently tagged CBR1 constructs for localization studies

    • Promoter replacement for controlled expression timing

  • Infection assays with modified strains:

    • Quantitative assessment of virulence on maize

    • Microscopic analysis of infection structures

    • Timepoint sampling for stage-specific analysis

    • Comparison of disease progression with wild-type

  • Expression profiling during infection:

    • RT-qPCR analysis of CBR1 expression at different infection stages

    • RNA-seq to identify co-regulated genes

    • Comparative transcriptomics between wild-type and Δcbr1 mutants

    • Similar techniques have shown stage-specific expression of genes in U. maydis

  • Metabolomic analyses:

    • LC-MS or GC-MS profiling of lipids and sterols

    • Comparison between infected and uninfected tissues

    • Metabolite differences between wild-type and Δcbr1 infections

    • Focus on sterols, fatty acids, and sphingolipids that are likely affected

  • Microscopy techniques:

    • Fluorescence microscopy for protein localization

    • Confocal imaging of infection structures

    • Transmission electron microscopy for ultrastructural analysis

    • Co-localization studies with interacting partners

  • Host response analysis:

    • Monitoring ROS production at infection sites

    • Transcriptome analysis of infected host tissue

    • Comparison of defense gene activation between wild-type and mutant infections

    • Similar approaches revealed that plant peroxidase POX12 is induced during U. maydis infection

An experimental workflow might include:

PhaseApproachesExpected Outcomes
Early infection (0-2 days)Live imaging, ROS detectionCBR1 role in oxidative stress response
Biotrophic growth (3-6 days)Transcriptomics, metabolomicsCBR1 function in nutrient acquisition
Tumor formation (7-14 days)Histology, microscopyCBR1 role in morphogenesis
Sporulation (>14 days)Spore quantification, TEMCBR1 function in spore development

This multi-faceted approach would provide comprehensive understanding of CBR1 function throughout the U. maydis infection cycle.

How does U. maydis CBR1 compare functionally to cytochrome b5 reductases in other fungi?

U. maydis CBR1 shares fundamental functions with cytochrome b5 reductases from other fungi, but with species-specific adaptations:

Comparative functional analysis:

Fungal SpeciesCBR1 FunctionsUnique FeaturesReference
U. maydisElectron transfer, sterol metabolism, pathogenicityTwo distinct CBR proteins (CBR1 and CBR2)
Neurospora crassaFatty acid desaturation, membrane biogenesisLonger N-terminal domain
Candida albicansDrug metabolism, azole resistanceImportant for virulence in animal hosts
Zymoseptoria triticiSterol biosynthesis, stress response, sporulationPossible role in azole fungicide tolerance
Saccharomyces cerevisiaeSterol and fatty acid metabolismWell-characterized role in ergosterol biosynthesis

Key functional differences:

  • Pathogenicity contributions:

    • Plant pathogens (U. maydis, Z. tritici): CBR1 is critical for plant infection processes

    • Animal pathogens (C. albicans): CBR1 contributes to animal host colonization

    • Non-pathogens (S. cerevisiae): CBR1 functions primarily in metabolic processes

  • Sterol utilization:

    • U. maydis and other plant pathogens have evolved specialized mechanisms to utilize plant sterols

    • U. maydis cannot synthesize sterols independently and relies on host-derived sterols

    • CBR1 appears critical for this sterol acquisition and processing

  • Stress response specialization:

    • U. maydis faces unique oxidative challenges during plant infection

    • CBR1 functions appear adapted to handling plant-derived defensive compounds

    • This may include specific interactions with plant peroxidases and phenolic compounds

  • Phenolic compound interactions:

    • U. maydis CBR1 may have specialized functions for dealing with plant phenolics

    • Research with the U. maydis PR-1-like protein shows this fungus has evolved mechanisms to sense and respond to plant phenolic compounds

    • Similar adaptations may exist in the CBR system

These functional comparisons suggest that while the fundamental enzymatic activity is conserved, U. maydis CBR1 has evolved specialized functions related to its biotrophic lifestyle and interactions with its maize host.

What evolutionary patterns can be observed in CBR1 across fungal species?

Evolutionary analysis of CBR1 across fungal lineages reveals intriguing patterns of conservation and adaptation:

  • Domain conservation and divergence:

    • Catalytic domains show high conservation across fungi

    • FAD and NADH binding sites maintain critical residues

    • Membrane-anchoring domains show greater divergence

    • N-terminal regions exhibit the most variability, suggesting adaptation to specific cellular contexts

  • Duplication and specialization:

    • Many fungi possess multiple CBR genes (e.g., CBR1, CBR2, MCR1)

    • U. maydis has at least two distinctive CBR genes (CBR1 and MCR1)

    • Gene duplication has allowed functional specialization:

      • CBR1: Primary microsomal form

      • MCR1: Mitochondrial form with distinct functions

  • Pathogen-specific adaptations:

    • Plant pathogens show evidence of selection in regions interacting with host molecules

    • CBR1 in biotrophic fungi (like U. maydis) shows patterns consistent with adaptation to long-term host association

    • Regions involved in response to host defense compounds show accelerated evolution

  • Taxonomic distribution:

    • Core CBR function is present across all fungal lineages

    • Basidiomycetes (including U. maydis) show distinctive features compared to Ascomycetes

    • U. maydis CBR1 clusters with other smut fungi (Ustilaginomycetes)

  • Structural adaptations:

    • Subtle amino acid changes in the catalytic domain likely reflect adaptation to specific substrates

    • Variations in membrane-binding domains correlate with different subcellular localizations

    • Species-specific insertions or deletions may accommodate interactions with lineage-specific partners

This evolutionary pattern reflects the fundamental importance of CBR1 in fungal metabolism while highlighting how this enzyme family has been adapted to support diverse lifestyles, including the specialized biotrophic pathogenicity exhibited by U. maydis.

What are the current limitations in studying U. maydis CBR1 and how might they be overcome?

Research on U. maydis CBR1 faces several technical and conceptual challenges:

Current limitations and potential solutions:

  • Membrane protein purification challenges:

    • Problem: Full-length CBR1 contains a membrane-anchoring domain that complicates purification and crystallization

    • Solutions:

      • Use detergent screening to identify optimal solubilization conditions

      • Generate truncated constructs focusing on catalytic domains

      • Employ nanodiscs or amphipols for membrane protein stabilization

      • Consider protein fusion partners to enhance solubility

  • Functional redundancy:

    • Problem: U. maydis possesses multiple cytochrome b5 reductases (CBR1, CBR2, MCR1) with potentially overlapping functions

    • Solutions:

      • Create combinatorial gene deletions

      • Use conditional expression systems to control multiple genes

      • Develop specific inhibitors for different reductase isoforms

      • Perform detailed kinetic characterization to identify functional differences

  • In planta analysis limitations:

    • Problem: Studying CBR1 function during plant infection is challenging due to complex host-pathogen interactions

    • Solutions:

      • Develop biosensors for real-time monitoring of enzyme activity in planta

      • Use inducible promoters for stage-specific gene manipulation

      • Employ single-cell transcriptomics for cell-type specific analysis

      • Develop microfluidic systems for controlled host-pathogen interactions

  • Structure determination challenges:

    • Problem: No crystal structure exists specifically for U. maydis CBR1

    • Solutions:

      • Apply cryo-EM techniques, which have improved for smaller proteins

      • Use homology modeling based on related structures

      • Employ hydrogen-deuterium exchange mass spectrometry for structural insights

      • Consider NMR for domain-specific structural analysis

  • Integration of CBR1 into metabolic networks:

    • Problem: Understanding how CBR1 functions within the broader metabolic network of U. maydis

    • Solutions:

      • Apply systems biology approaches combining transcriptomics, proteomics, and metabolomics

      • Develop genome-scale metabolic models for U. maydis

      • Use isotope labeling to track specific metabolic fluxes

      • Employ network analysis to identify key interactions

Future research will likely benefit from integrating these approaches to build a comprehensive understanding of CBR1 function within the context of U. maydis biology and pathogenicity.

What novel research directions might expand our understanding of U. maydis CBR1 function?

Several promising research directions could significantly advance our understanding of U. maydis CBR1:

  • CBR1 as a target for agricultural applications:

    • Develop specific inhibitors of fungal CBR1 as potential antifungal compounds

    • Explore how natural plant compounds might interact with CBR1 function

    • Investigate whether plant resistance mechanisms target CBR1-dependent processes

    • This approach could lead to new strategies for managing corn smut disease

  • Synthetic biology applications:

    • Engineer CBR1 variants with altered substrate specificities

    • Explore potential biotechnological applications in biocatalysis

    • Design chimeric proteins combining domains from different CBRs to create novel functions

    • Investigate whether engineered CBR1 could support production of valuable compounds

  • CBR1 in fungal communication with the host:

    • Explore potential roles in sensing host metabolites

    • Investigate whether CBR1 activity influences effector production or secretion

    • Study potential connections between CBR1 and specialized fungal structures like the biotrophic interface

    • Examine whether host responses are calibrated to detect CBR1-dependent fungal activities

  • Evolutionary biology perspectives:

    • Compare CBR1 across multiple smut fungi to understand host-specific adaptations

    • Study coevolution between plant defense mechanisms and fungal CBR systems

    • Investigate whether CBR1 functions have been horizontally transferred between fungal lineages

    • Perform phylogenetic analyses to understand the evolutionary history of CBR gene duplications

  • Integration with emerging technologies:

    • Apply CRISPR-based screening to identify genetic interactions with CBR1

    • Develop biosensors to monitor CBR1 activity in real-time during infection

    • Use spatial transcriptomics to map CBR1 expression patterns in fungal colonies and infection structures

    • Apply advanced imaging techniques to visualize CBR1-dependent processes during host colonization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.