Recombinant Ustilago maydis Palmitoyltransferase PFA4 (PFA4)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant PFA4 is synthesized using heterologous expression systems. Technical specifications from production protocols include:

ParameterDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, or Cell-Free Expression
Purity≥85% (verified by SDS-PAGE)
Gene IDUMAG_11136 (U. maydis-specific)
Resistance MarkersCarboxin resistance for selection in fungal systems

Comparative analysis of PFA4 orthologs across fungal species highlights conserved production methodologies :

SpeciesGene NameHost SystemPurity
Ustilago maydisUMAG_11136Cell-Free Expression≥85%
Cryptococcus neoformansCNB04690E. coli/Yeast≥85%
Candida glabrataCAGL0E02497gBaculovirus≥85%

Research Applications

Recombinant PFA4 serves as a tool for:

  • Enzymatic Studies: Investigating substrate specificity and catalytic mechanisms of DHHC palmitoyltransferases.

  • Fungal Genetic Engineering: Used in conjunction with Carboxin resistance markers for transformation protocols in U. maydis .

  • Comparative Genomics: Analyzing evolutionary conservation of lipid modification pathways across fungi .

Knowledge Gaps and Future Directions

  • Functional Characterization: The specific substrates and biological roles of PFA4 in U. maydis remain unvalidated.

  • Pathogenicity Linkages: No studies directly associate PFA4 with U. maydis virulence, unlike its O-mannosyltransferase counterpart PMT4 .

  • Structural Studies: High-resolution crystallography or cryo-EM data are lacking for this enzyme.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
PFA4; UMAG_11136; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus)
Target Names
PFA4
Target Protein Sequence
MTNQDPDDGAYPSSQSDDDGIEALAINRQSRPLLAYEDQAAGQSDAFTDRDIPASTAPLT GRRRTPLSWTEVIWVSLTLLLIAVLGYSSQLYVMLPYYEKTPSFSPQALAAVLVPFNLGL LAIYYNYWLCVTTDAGSVPAGWQPEWSALEPVASLAELEHLHLVAEEEPSLELKQAIYRP RYCKTCSAFKPPRSHHCKTCQRCVLRMDHHCPWLANCVGHFNHAHFIRFLFYVDVTCLYH LIMISCRVLDSFNSYTYWREPCARELVWLVVNYALCIPVILLVGIFSLYHFYCLAVNQTT IESWEKDRTATMIRRGRVRKVKYPYDLGLWRNVRQVLGASPLVWCLPGAGARMAGDGLKY PVANGLGKSSRAWGSFRSHKSRHWMLQTMLQDSHVALGERQQCTDSLTYSVDVHDQESYV DPELEASVMHRLRWENWHRQQARLRVPSARLKAGVRQSGALLSVSFQAGWTDIPIHESLD TVTDSVLHTDSGSQYRWPPKDPSRPHPSRRTWASSSSPFTYPERSNPILDPTLSTRFPHN SSPSSSDSHSSLHLPHPPSLLDPLPHHFDPPHDPDTQPVNCPKRVSVRRGSEGYEVRPHT PWSV
Uniprot No.

Target Background

Function
PFA4, a palmitoyltransferase from *Ustilago maydis*, facilitates the reversible addition of palmitate to target proteins. This palmitoylation process regulates the membrane association and biological function of these proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Ustilago maydis Palmitoyltransferase PFA4 and what is its role in cellular processes?

Ustilago maydis Palmitoyltransferase PFA4 (PFA4) is a protein S-acyltransferase (PAT) enzyme that plays a crucial role in post-translational modification of proteins through palmitoylation. This 604-amino acid protein (UMAG_11136) belongs to the family of protein fatty acyltransferases and is specifically involved in the palmitoylation of transmembrane proteins . As a member of the DHHC-domain containing palmitoyltransferases, PFA4 catalyzes the addition of palmitate to specific substrate proteins, which affects their membrane localization, stability, and function .

In Ustilago maydis, a basidiomycete fungal pathogen, PFA4 likely contributes to various cellular processes including protein trafficking, localization, and potentially pathogenicity mechanisms. The protein contains the characteristic DHHC domain, which is critical for its catalytic activity in transferring palmitate groups to substrate proteins .

What expression systems are most effective for producing recombinant Ustilago maydis PFA4?

The most effective expression systems for producing recombinant Ustilago maydis PFA4 depend on the research objectives and downstream applications. Based on current methodologies:

E. coli Expression System:

  • Commonly used for producing the recombinant full-length Ustilago maydis PFA4 with N-terminal His-tag

  • Advantages include high yield, simplicity, and cost-effectiveness

  • The protein can be expressed as a full-length construct (1-604 amino acids)

Expression System Optimization Table:

Expression SystemAdvantagesLimitationsYieldRecommended for
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, potential folding issues with transmembrane proteinsUp to 10 mg/L cultureStructural studies, antibody production, in vitro assays
Yeast (P. pastoris)Eukaryotic modifications, suitable for membrane proteinsLonger production time, more complex2-5 mg/L cultureFunctional studies requiring proper folding
Insect cellsSuperior folding of eukaryotic proteins, post-translational modificationsExpensive, technical expertise required1-3 mg/L cultureActivity assays, interaction studies

When using E. coli for expression, researchers should consider using specialized strains designed for membrane protein expression and optimize induction conditions to maximize protein folding and stability .

What purification strategies yield the highest purity and activity for recombinant PFA4?

Achieving high purity and activity for recombinant Ustilago maydis PFA4 requires careful consideration of its membrane protein characteristics. The following purification strategy has been demonstrated to be effective:

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-TALON resins for His-tagged PFA4

    • Washing with increasing imidazole concentrations (10-40 mM) to remove non-specifically bound proteins

    • Elution with 250-300 mM imidazole buffer

  • Detergent Selection:

    • Critical for maintaining the native conformation of this transmembrane protein

    • Mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl maltose neopentyl glycol) at 1-2× CMC

  • Storage Conditions:

    • Lyophilization in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0

    • For reconstitution, using deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

  • Activity Preservation:

    • Avoiding repeated freeze-thaw cycles

    • Storing working aliquots at 4°C for no more than one week

How can researchers assess the catalytic activity of recombinant PFA4 in vitro?

Assessment of recombinant PFA4 catalytic activity in vitro requires specialized assays that measure palmitate transfer to substrate proteins. The following methodological approaches are recommended:

1. Acyl-Biotin Exchange (ABE) Assay:

  • This technique allows detection and quantification of protein S-acylation

  • The process involves:

    • Blocking free thiols with N-ethylmaleimide (NEM)

    • Cleaving thioester bonds with hydroxylamine (HAM)

    • Labeling newly exposed thiols with biotin-HPDP

    • Detection via Western blot with streptavidin-HRP or anti-biotin antibodies

  • This method has been successfully applied to measure palmitoylation of substrates like Chs3 by Pfa4 variants

2. Metabolic Labeling with Palmitate Analogs:

  • Incorporation of alkyne/azide-modified palmitate analogs into substrate proteins

  • Click chemistry coupling with fluorescent or affinity tags

  • Visualization via SDS-PAGE or detection via mass spectrometry

3. Direct Enzyme Activity Assay:

  • Incubation of purified PFA4 with substrate protein and palmitoyl-CoA

  • Measurement of palmitoyl transfer rate using:

    • Radioactive [³H]- or [¹⁴C]-palmitoyl-CoA

    • HPLC or TLC detection of palmitoylated products

    • Mass spectrometry to identify palmitoylation sites

These methodologies can be adapted to compare wildtype and mutant forms of PFA4, enabling structure-function analyses of the catalytic domain.

What is the significance of the DHHC motif in PFA4 function, and how do mutations affect enzyme activity?

The DHHC motif (Asp-His-His-Cys) is a defining feature of palmitoyltransferases and plays a critical role in the catalytic mechanism of PFA4. Research has revealed fascinating insights about the plasticity of this motif:

DHHC Motif Function:

  • The cysteine residue within the DHHC motif is generally considered essential for forming a palmitoyl-enzyme intermediate during catalysis

  • The histidine residues are thought to contribute to the nucleophilicity of the catalytic cysteine

  • The aspartate may play a structural role in positioning the histidines

Effects of DHHC Mutations:
Studies on related palmitoyltransferases have demonstrated that mutations in the DHHC motif do not always completely abolish activity:

  • DHHR Mutation (Cys→Arg):

    • Retains approximately two-thirds of wild-type activity when overexpressed

    • Demonstrates that the canonical cysteine is not absolutely required for activity

  • DHHA Mutation (Cys→Ala):

    • Maintains approximately one-third of wild-type activity

    • Further supports the unexpected finding that the DHHC motif has functional flexibility

  • DQHC Mutation (His→Gln):

    • Partially active in related palmitoyltransferases

    • Indicates that the first histidine can be substituted while maintaining some function

These findings challenge the conventional understanding of the DHHC motif and suggest that:

  • Alternative catalytic mechanisms may exist

  • Substrate recognition and binding may contribute significantly to catalysis

  • The protein's structure may compensate for mutations in the canonical motif

For researchers working with Ustilago maydis PFA4, these insights provide opportunities to explore structure-function relationships through directed mutagenesis of the DHHC domain.

How can recombinant PFA4 be used to study protein-protein interactions in Ustilago maydis?

Recombinant PFA4 provides a powerful tool for investigating protein-protein interactions (PPIs) in Ustilago maydis, particularly those involving palmitoylation-dependent processes. Several methodological approaches can be employed:

1. Affinity Purification Coupled with Mass Spectrometry (AP-MS):

  • His-tagged recombinant PFA4 can be used as bait to capture interacting proteins

  • Cross-linking agents can stabilize transient interactions

  • Following purification, interacting proteins are identified by mass spectrometry

  • This approach can identify both substrates and regulatory partners of PFA4

2. Yeast Two-Hybrid (Y2H) Screening with U. maydis cDNA Library:

  • Testing interactions between PFA4 domains and potential partners

  • The method can identify both substrates and regulatory proteins

  • Catalytically inactive mutants (e.g., DHHA variants) may be particularly useful as they might trap substrates in abortive complexes

3. Bioluminescence Resonance Energy Transfer (BRET) or Förster Resonance Energy Transfer (FRET):

  • For real-time monitoring of protein interactions in living cells

  • PFA4 fused to a donor fluorophore and potential interactors fused to acceptors

  • Enables detection of dynamic, palmitate-dependent interactions

4. Proximity-Dependent Biotin Identification (BioID):

  • PFA4 fused to a biotin ligase (e.g., BirA*) identifies proteins in proximity

  • Particularly valuable for capturing transient interactions that occur during palmitoylation

  • Can reveal the spatial organization of PFA4 and its substrates in cellular compartments

These approaches can help elucidate PFA4's role in important cellular processes, including those related to the pathogenicity of Ustilago maydis.

What roles might PFA4 play in Ustilago maydis pathogenicity, and how can recombinant protein studies inform this understanding?

PFA4 may significantly contribute to Ustilago maydis pathogenicity through several mechanisms that can be investigated using recombinant protein approaches:

Potential Pathogenicity Roles:

  • Effector Protein Modification:

    • U. maydis secretes numerous effector proteins during host infection

    • Palmitoylation may regulate the localization, secretion, or function of these effectors

    • Studies in other fungi suggest that palmitoylation can affect virulence factor delivery

  • Cell Wall Integrity and Morphology:

    • PFA4 might palmitoylate proteins involved in cell wall synthesis or remodeling

    • In related systems, Pfa4 palmitoylates Chs3, a chitinase involved in chitin synthesis

    • U. maydis undergoes morphological transitions during infection that may be regulated by palmitoylated proteins

  • Unconventional Protein Secretion:

    • U. maydis employs cytokinesis-dependent unconventional secretion for proteins like chitinase Cts1

    • Palmitoylation may regulate components of these specialized secretion pathways

Research Approaches Using Recombinant PFA4:

  • Substrate Identification:

    • In vitro palmitoylation assays with recombinant PFA4 and candidate virulence proteins

    • Proteomic analysis comparing palmitoylomes of wild-type and PFA4-deficient strains

    • Potential targets include proteins identified in secretome analyses

  • Functional Complementation:

    • Using recombinant PFA4 variants to complement PFA4 deletion mutants

    • Assessing restoration of virulence in plant infection assays

    • Structure-function analysis to identify domains critical for pathogenicity

  • Inhibitor Development and Validation:

    • Screening for specific inhibitors of U. maydis PFA4 using the recombinant protein

    • Testing inhibitor effects on fungal growth, morphology, and virulence

    • Validating PFA4 as a potential antifungal target

Understanding PFA4's role in pathogenicity could provide insights into the molecular mechanisms of U. maydis infection and potentially reveal new targets for disease control strategies.

What are the primary challenges in working with recombinant membrane proteins like PFA4, and how can they be addressed?

Working with recombinant membrane proteins like Ustilago maydis PFA4 presents several technical challenges. Here are the major obstacles and methodological solutions:

Challenge 1: Protein Expression and Solubility

  • Membrane proteins often form inclusion bodies or aggregate when overexpressed

  • Solutions:

    • Use specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

    • Optimize expression conditions: lower temperature (16-18°C), reduced inducer concentration

    • Employ fusion partners like MBP or SUMO to enhance solubility

    • Consider cell-free expression systems for difficult constructs

Challenge 2: Protein Extraction and Purification

  • Efficient extraction from membranes without denaturing the protein

  • Solutions:

    • Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction

    • Use mild solubilization conditions (4°C, gentle agitation)

    • Two-step purification: IMAC followed by size exclusion chromatography

    • Consider detergent-lipid mixed micelles to maintain native-like environment

Challenge 3: Maintaining Enzyme Activity

  • PATs often lose activity during purification and storage

  • Solutions:

    • Add lipids (e.g., cholesterol, phosphatidylcholine) during purification

    • Include reducing agents (DTT, TCEP) to protect the catalytic cysteine

    • Stabilize with trehalose (6%) during lyophilization

    • Store with glycerol (5-50%) to prevent freeze-damage

Challenge 4: Assessing Protein Quality

  • Determining proper folding and oligomeric state

  • Solutions:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Functional assays to confirm catalytic activity

    • Thermal shift assays to evaluate protein stability

How can researchers overcome protein aggregation issues when working with recombinant PFA4?

Protein aggregation is a significant challenge when working with recombinant PFA4, particularly given its multiple transmembrane domains. Research has shown that DHHC proteins can form oligomers or aggregates, as observed with Pfa4 DHHA and DHHR mutants . Here are methodological approaches to minimize aggregation:

1. Buffer Optimization:

  • Screen various buffer conditions:

    • pH range (7.0-8.5)

    • Ionic strength (100-500 mM NaCl)

    • Buffer systems (HEPES, Tris, phosphate)

  • Include stabilizing additives:

    • Glycerol (10-20%)

    • Arginine (50-200 mM)

    • Trehalose (5-10%)

    • Low concentrations of non-ionic detergents

2. Detergent Selection and Optimization:

  • Systematic detergent screening:

Detergent ClassExamplesWorking ConcentrationBest For
MaltosidesDDM, UDM1-2× CMCGeneral purpose, maintains activity
Neopentyl glycolsLMNG, OGNG1-3× CMCEnhanced stability, crystallization
GlucosidesOG, NG1.5-2× CMCStringent purification steps
Fos-cholineFC-12, FC-141-2× CMCHighly hydrophobic proteins
  • Consider detergent exchange during purification steps

  • Test mixed micelles (combining different detergents) or lipid-detergent mixtures

3. Protein Engineering Approaches:

  • Design constructs with:

    • Removal of disordered regions

    • Addition of solubilizing tags (MBP, SUMO)

    • Mutation of aggregation-prone residues

  • Test expression of individual domains if the full protein proves problematic

4. Processing Methods to Reduce Aggregation:

  • Optimize sample handling:

    • Maintain cold temperatures throughout purification

    • Use centrifugal filtration rather than precipitation for concentration

    • Apply on-column detergent exchange during affinity purification

    • Consider membrane scaffold proteins (MSPs) for reconstitution into nanodiscs

5. Analytical Methods to Monitor Aggregation:

  • Dynamic light scattering (DLS) to assess particle size distribution

  • Size exclusion chromatography to separate monomeric from aggregated species

  • Analytical ultracentrifugation to determine oligomeric states

  • Western blot analysis with non-heated samples to preserve native oligomeric state

By implementing these methodological approaches, researchers can significantly improve the quality and consistency of recombinant PFA4 preparations for structural and functional studies.

How can researchers use recombinant PFA4 knowledge to design effective gene deletion or mutation studies in Ustilago maydis?

Recombinant PFA4 studies provide valuable insights for designing genetic manipulation experiments in Ustilago maydis. The following methodological approaches leverage this knowledge:

1. Targeted Gene Replacement Strategies:

  • Design deletion constructs based on recombinant protein domain analysis

  • Utilize homologous recombination system of U. maydis for precise genetic manipulation

  • Implement the FLP-mediated recombination system for marker recycling, allowing:

    • Sequential gene deletions in multigene families

    • Introduction of multiple mutations using limited selectable markers

    • Avoidance of genome rearrangements by using mutated FRT sites

2. Structure-Function Analysis via Domain-Specific Mutations:

  • Target the DHHC motif with specific mutations (DHHA, DHHR) shown to affect but not eliminate activity

  • Create chimeric constructs swapping domains with other PATs to identify substrate specificity regions

  • Use alanine-scanning mutagenesis of conserved residues identified in recombinant protein studies

3. Conditional Expression Systems:

  • Design regulatable promoter constructs for PFA4:

    • Inducible systems (e.g., arabinose or tetracycline-responsive)

    • Tissue-specific promoters for in planta expression studies

    • Degron tags for rapid protein depletion

4. Tagged Variants for In Vivo Localization:

  • Create fluorescent protein fusions informed by recombinant protein topology studies

  • Position tags at sites known not to interfere with activity from in vitro studies

  • Generate epitope-tagged versions for immunoprecipitation experiments

5. CRISPR-Cas9 Genome Editing Strategy:

  • Design guide RNAs targeting specific PFA4 domains

  • Create repair templates for precise introduction of mutations

  • Implement multiplexed editing for simultaneous modification of related PAT genes

These approaches benefit from the U. maydis homologous recombination system, which offers distinct advantages compared to baker's yeast, including the use of a BRCA2 homolog rather than Rad52 as a mediator of Rad51 .

What approaches can be used to identify and validate physiological substrates of PFA4 in Ustilago maydis?

Identifying and validating the physiological substrates of PFA4 in Ustilago maydis requires a multi-faceted approach combining in vitro and in vivo methodologies:

1. Global Palmitoylome Analysis:

  • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC) coupled with mass spectrometry

  • Compare palmitoylomes between:

    • Wild-type and PFA4 deletion strains

    • Strains expressing wild-type vs. catalytically impaired PFA4 (DHHA mutant)

  • Metabolic labeling with clickable palmitate analogs (17-ODYA, Alk-C16) followed by click chemistry and proteomics

2. Candidate Approach Based on Phenotypic Analysis:

  • Examine PFA4 deletion phenotypes to identify affected cellular processes

  • Screen proteins involved in these processes for palmitoylation

  • Focus on:

    • Transmembrane proteins (known preferred substrates of Pfa4 in other systems)

    • Proteins involved in cell wall integrity (e.g., chitinases, similar to Chs3 in yeast)

    • Effector proteins and virulence factors

3. Direct In Vitro Validation:

  • Express and purify candidate substrates as recombinant proteins

  • Perform in vitro palmitoylation assays using recombinant PFA4

  • Identify specific palmitoylation sites using mass spectrometry

  • Confirm enzymatic parameters (Km, Vmax) to assess substrate preference

4. In Vivo Validation Techniques:

  • Generate non-palmitoylatable mutants of candidate substrates (Cys→Ala)

  • Assess phenotypic consequences and compare to PFA4 deletion

  • Perform complementation studies with various PFA4 mutants

  • Use proximity labeling techniques (BioID, APEX) with PFA4 fusions to identify physically interacting proteins

5. Functional Validation Through Phenotypic Analysis:

  • Analysis of subcellular localization changes when palmitoylation is disrupted

  • Assessment of protein stability and turnover rates

  • Evaluation of protein-protein interactions dependent on palmitoylation

  • Examination of effects on fungal morphology, growth, and pathogenicity

These comprehensive approaches will provide insights into the substrate specificity of PFA4 and its functional role in Ustilago maydis biology and pathogenicity.

How does Ustilago maydis PFA4 compare structurally and functionally to palmitoyltransferases in other fungi and organisms?

Ustilago maydis PFA4 shares evolutionary relationships with palmitoyltransferases across different kingdoms while displaying distinct features. This comparative analysis provides valuable insights:

Structural Comparison:

FeatureU. maydis PFA4S. cerevisiae Pfa4Mammalian DHHC PATs
Protein Size604 amino acids ~550 amino acids250-700 amino acids
DHHC DomainPresent (DHHC motif within a cysteine-rich domain) PresentPresent
Transmembrane DomainsMultiple predicted4 transmembrane domains4 transmembrane domains
N-terminal DomainExtended (~120 aa) Variable lengthVariable length
C-terminal DomainExtended with distinctive proline-rich regions Variable lengthOften contains PDZ-binding motifs

Functional Comparison:

  • Substrate Specificity:

    • U. maydis PFA4, like S. cerevisiae Pfa4, likely specializes in transmembrane protein substrates

    • This contrasts with some mammalian DHHCs that target soluble proteins

    • The specific sequence determinants for substrate recognition may differ between species

  • Catalytic Flexibility:

    • Studies on related Pfa4 show unexpected catalytic activity even with DHHC motif mutations

    • The DHHR and DHHA mutants retain partial activity, suggesting mechanistic plasticity

    • This feature might be conserved in U. maydis PFA4, offering opportunities for comparative enzymology

  • Cellular Localization:

    • S. cerevisiae Pfa4 localizes to the endoplasmic reticulum

    • U. maydis PFA4 localization is not definitely established but sequence features suggest similar ER localization

    • Mammalian DHHCs distribute across various compartments (ER, Golgi, plasma membrane)

Evolutionary Context:

U. maydis, as a basidiomycete fungus, is evolutionarily distant from the ascomycete S. cerevisiae, offering a valuable comparative perspective . The homologous recombination system and other cellular machinery in U. maydis show more similarities to mammals than to S. cerevisiae in some aspects , suggesting that studies of U. maydis PFA4 may provide insights relevant to understanding mammalian PATs.

What bioinformatic approaches can researchers use to predict potential substrates and interaction partners of PFA4?

Researchers can employ several sophisticated bioinformatic approaches to predict potential substrates and interaction partners of Ustilago maydis PFA4:

1. Palmitoylation Site Prediction:

  • Computational algorithms to identify potential palmitoylation sites:

    • CSS-Palm, GPS-Lipid, IFS-Palm, PalmPred

    • These tools analyze amino acid sequences for features associated with palmitoylation sites

  • Structural context analysis:

    • Identify cysteines proximal to transmembrane domains

    • Assess local hydrophobicity and amino acid composition

    • Evaluate structural accessibility of candidate cysteines

2. Ortholog-Based Substrate Prediction:

  • Identify known substrates of Pfa4 orthologs in other fungi (e.g., S. cerevisiae Pfa4 substrates)

  • Search for U. maydis homologs of these proteins

  • Compare sequence conservation around palmitoylated cysteines

  • Weighted scoring system incorporating:

    • Sequence similarity to known substrates

    • Conservation of palmitoylation sites

    • Shared cellular localization or function

3. Protein-Protein Interaction Network Analysis:

  • Construct interaction networks using:

    • Experimental data from model organisms

    • Predicted interactions based on domain-domain interactions

    • Co-expression patterns across conditions

  • Apply graph theory algorithms to identify high-confidence candidates

  • Prioritize proteins that interact with known substrates or related pathways

4. Machine Learning Approaches:

  • Train models using known palmitoyltransferase-substrate pairs

  • Feature extraction from:

    • Protein sequences and domains

    • Secondary structure and disorder predictions

    • Evolutionary conservation patterns

    • Physico-chemical properties

  • Apply trained models to predict U. maydis PFA4 substrates

  • Implement ensemble methods combining multiple prediction algorithms

5. Comparative Genomics and Phylogenetic Profiling:

  • Compare presence/absence patterns of PFA4 and potential substrates across fungal species

  • Identify proteins with correlated evolutionary histories

  • Analyze co-evolution of specific residues between PFA4 and candidate substrates

  • Leverage U. maydis' evolutionary position as a basidiomycete to provide distinct insights

6. Structural Modeling and Docking:

  • Generate structural models of U. maydis PFA4 using homology modeling

  • Predict substrate binding regions through conservation mapping

  • Perform in silico docking with candidate substrate proteins

  • Evaluate binding energy and interface complementarity

These computational approaches provide a foundation for generating testable hypotheses about PFA4 substrates and interaction partners, which can then be validated through the experimental methods discussed in previous sections.

How might recombinant PFA4 be used in developing new antifungal strategies against plant pathogens?

Recombinant Ustilago maydis PFA4 offers several promising avenues for developing novel antifungal strategies against plant pathogens:

1. High-Throughput Inhibitor Screening Platforms:

  • Using purified recombinant PFA4 to screen chemical libraries for specific inhibitors

  • Development of fluorescence-based enzymatic assays for rapid screening

  • Structure-guided rational design of inhibitors targeting the catalytic site

  • Assay design incorporating:

    • Fluorescently labeled palmitoyl-CoA substrates

    • FRET-based detection of palmitoylation activity

    • High-content imaging of substrate localization

2. Targeted Peptide Inhibitors:

  • Design of peptide-based competitive inhibitors that mimic substrate binding sites

  • Creation of stapled peptides for enhanced stability and cellular uptake

  • Development of peptidomimetics that block PFA4-substrate interactions

  • These approaches benefit from the structural insights gained from recombinant protein studies

3. Agricultural Applications:

  • Development of PFA4 inhibitors as environmentally friendly fungicides

  • Targeted spray applications during susceptible stages of the fungal lifecycle

  • Seed treatments to protect during early growth stages

  • Combination strategies with existing fungicides for enhanced efficacy

4. Host-Induced Gene Silencing (HIGS):

  • Engineering crop plants to express RNA interference constructs targeting PFA4

  • Design of efficient siRNA sequences based on recombinant protein studies

  • Creation of transgenic plants with enhanced resistance to U. maydis

  • This approach could provide sustained protection without chemical applications

5. Immunological Approaches:

  • Development of antibodies against specific PFA4 epitopes for detection and monitoring

  • Potential for antibody-based inhibition strategies

  • Creation of immunodiagnostic tools for early detection of infection

  • Recombinant PFA4 serves as both the immunogen and as a tool for antibody validation

The development of PFA4-targeted antifungal strategies could be particularly valuable because:

  • It represents a novel mode of action distinct from current commercial fungicides

  • The differences between fungal and mammalian palmitoyltransferases may allow for selective targeting

  • Inhibiting PFA4 affects multiple cellular processes simultaneously through its various substrates

What emerging technologies could advance our understanding of PFA4 structure and function in the next decade?

Several cutting-edge technologies are poised to revolutionize our understanding of PFA4 structure and function in the coming decade:

1. Advanced Structural Biology Techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Near-atomic resolution structures of membrane proteins without crystallization

    • Visualization of different conformational states during the catalytic cycle

    • Structures of PFA4 in complex with substrates and inhibitors

  • Integrative Structural Biology:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

    • Molecular dynamics simulations to understand conformational changes during catalysis

2. Single-Molecule Technologies:

  • Single-Molecule FRET:

    • Real-time observation of conformational changes during substrate binding and catalysis

    • Direct measurement of PFA4-substrate interaction kinetics

    • Monitoring of enzyme dynamics under different conditions

  • Optical Tweezers and Force Spectroscopy:

    • Measuring forces involved in protein-protein interactions

    • Understanding the mechanical aspects of membrane protein function

    • Investigating the energetics of substrate binding and product release

3. Advanced Genetic Manipulation:

  • CRISPR Base Editing and Prime Editing:

    • Precise introduction of point mutations without double-strand breaks

    • Saturation mutagenesis to comprehensively map structure-function relationships

    • In vivo editing to create designer PFA4 variants with altered specificity

  • Synthetic Biology Approaches:

    • Creation of minimal palmitoyltransferase systems

    • Development of orthogonal palmitoyltransferase-substrate pairs

    • Engineering PFA4 variants with novel substrate specificity

4. Spatiotemporal Protein Analysis:

  • Super-Resolution Microscopy:

    • Nanoscale visualization of PFA4 localization and dynamics

    • Multicolor imaging to track substrate interactions in real-time

    • Correlative light and electron microscopy for contextual structural information

  • Optogenetic Control:

    • Light-controlled activation or inhibition of PFA4

    • Precise temporal control of palmitoylation events

    • Investigation of acute versus chronic effects of PFA4 activity

5. Systems Biology Approaches:

  • Multi-omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Network analysis to understand PFA4's position in cellular signaling

    • Machine learning to predict system-wide effects of PFA4 perturbation

  • Spatial Transcriptomics and Proteomics:

    • Mapping PFA4 activity and its effects across different cellular compartments

    • Tissue-specific analysis during host infection

    • Single-cell analysis to capture population heterogeneity

These emerging technologies will provide unprecedented insights into the structural basis of PFA4 function, its cellular dynamics, and its role in Ustilago maydis biology and pathogenicity, potentially leading to novel applications in agriculture and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.