Recombinant Ustilago maydis Pheromone receptor 1 (PRA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include this information in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRA1; UMAG_02383; Pheromone receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus)
Target Names
PRA1
Target Protein Sequence
MLDHITPFFALVAFFLVLMPFAWHIKSKNVGLIMLSIWLMLGNLDNFVNSMVWWKTTADL APAYCELSVRLRHLLFIAIPASNLAIARKLESIASTRQVRAGPGDHRRAVIIDLLICLGI PIIYTSLMIVNQSNRYGILEEAGCWPMMVFSWLWVLLVAAPVIVVSLCSAVYSALAFRWF WVRRRQFQAVLASSASTINRSHYVRLLLLTAIDMLLFFPIYVGTIAAQIKSSISIPYGSW SSVHTGFNQIPQYPASLVLMENTFQRNLILARLVCPLSAYIFFAMFGLGLEVRQGYKEAF HRALLFCRLRKEPKASALQHVVADIEVVTFRSHDTFDANTSTKSEKSDIDMRGSEAA
Uniprot No.

Target Background

Function
Receptor for the A2 pheromone, a prenylated mating factor.
Database Links
Protein Families
G-protein coupled receptor 4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the role of PRA1 in Ustilago maydis mating and pathogenicity?

PRA1 is a G protein-coupled pheromone receptor localized to the plasma membrane that plays a crucial role in the initial steps of pathogenic development. It functions primarily in pheromone perception and is essential for cell-cell fusion during mating. Research demonstrates that PRA1 is constitutively endocytosed and critically involved in the recognition of mating partners at the beginning of the pathogenic program . The a mating type locus of U. maydis, which contains PRA1, houses the structural genes for a pheromone-based cell recognition system governing fusion of haploid cells, a prerequisite for the formation of the infectious dikaryon .

How does PRA1 coordinate with other regulatory elements during pathogenic development?

PRA1 functions within a complex regulatory network where the ability to infect plants and coordinate cell cycle progression are closely interconnected. This network involves the concerted action of both a and b mating-type loci . While PRA1 operates within the a locus pathway, its signaling leads to the activation of b genes, which subsequently regulate pathogenic development of the dikaryon . The zinc-finger transcription factor Rbf1 acts as a master regulator for pathogenic development, and the Clp1 protein interacts with Rbf1 in a manner that results in repression of the pheromone pathway . This complex interplay ensures proper coordination between mating, cell cycle progression, and host invasion.

What molecular mechanisms govern PRA1 trafficking in the cell membrane?

PRA1 is actively regulated through endocytosis, which plays a critical role in receptor function. The receptor localizes to the plasma membrane but undergoes constitutive endocytosis as part of its normal cellular cycling . This trafficking depends on the endosomal target soluble N-ethylmaleimide-sensitive factor attachment protein receptor Yup1, which mediates fusion of endocytic transport vesicles with early endosomes . When endocytosis is blocked, as in Yup1(ts) mutants, PRA1-carrying endocytic vesicles accumulate in the cytoplasm, depleting the receptor from the membrane and impairing pheromone perception and conjugation hyphae formation .

What expression systems are most effective for producing functional recombinant PRA1?

For recombinant PRA1 expression, heterologous systems must be carefully selected to maintain protein functionality. Given that PRA1 is a membrane-bound G protein-coupled receptor, expression in fungal systems most closely related to U. maydis often yields the best results. When working with PRA1, fusion proteins with fluorescent tags (such as PRA1-GFP) have proven effective in maintaining biological activity while enabling visualization . The expression system should include considerations for proper membrane integration, as surface localization is critical for function. Expression vectors utilizing constitutive promoters like otef (as used for other U. maydis proteins) can provide consistent expression levels , though inducible systems offer better control when studying potential toxic effects of receptor overexpression.

What methods effectively track PRA1 localization and endocytosis in living cells?

Tracking PRA1 localization in living cells requires fluorescent protein fusion constructs combined with advanced microscopy techniques. Biologically active PRA1-GFP constructs have successfully demonstrated that the receptor localizes to the plasma membrane and undergoes constitutive endocytosis . For quantitative assessment of trafficking dynamics, researchers should implement time-lapse confocal microscopy with appropriately labeled cellular compartment markers. Co-localization studies with endosomal markers can confirm the trafficking pathway. When investigating endocytosis defects, temperature-sensitive mutants like Yup1(ts) provide valuable tools for analyzing how disrupted endocytic processes affect receptor distribution and function . Comparative analysis between wild-type and mutant cells reveals the critical contribution of endocytosis to receptor homeostasis.

How can researchers effectively measure PRA1-mediated pheromone signaling activation?

Measuring PRA1-mediated signaling requires multi-level analysis of the pheromone response pathway. At the transcriptional level, researchers should utilize reporter constructs containing the 9 bp pheromone response element (ACAAAGGGA) that mediates pheromone-induced gene expression . Quantitative PCR analysis of pheromone-induced genes provides another readout, as these genes fall into three classes based on their expression patterns before and after cell fusion . At the cellular level, the formation of conjugation hyphae serves as a visual indicator of successful signaling . For more direct biochemical assessment, analyzing the phosphorylation states of downstream MAPK pathway components can provide quantitative measurements of receptor activation. Complementation experiments in receptor-deficient strains offer definitive evidence of functional activity.

How does disruption of PRA1 endocytosis specifically impact different stages of the U. maydis life cycle?

Disruption of PRA1 endocytosis has stage-specific impacts throughout the U. maydis life cycle. Research using temperature-sensitive mutants in the endosomal protein Yup1 demonstrates that endocytosis is essential for the initial steps of pathogenic development, particularly pheromone perception and cell-cell fusion . Without proper endocytosis, PRA1 accumulates in cytoplasmic vesicles rather than maintaining appropriate membrane levels, severely impairing pheromone recognition . Beyond these initial steps, endocytosis disruption dramatically reduces spore formation and germination, suggesting multiple roles for endocytic processes throughout fungal development . Interestingly, while plant colonization is affected, it is only slightly inhibited compared to the profound defects in earlier developmental stages, indicating differential requirements for endocytosis throughout the life cycle .

What is the relationship between PRA1-mediated signaling and the b-dependent pathogenic program?

PRA1-mediated signaling and the b-dependent pathogenic program are intricately connected with coordinated regulatory mechanisms. The pheromone recognition system involving PRA1 initiates the mating process, but crucially, research has shown that expression of b genes, which regulate pathogenic development of the dikaryon, is also stimulated by pheromone signaling . This indicates a regulatory cascade where PRA1 activation leads to b gene expression. Furthermore, the interaction between the Clp1 protein and the master regulator Rbf1 results in repression of the pheromone pathway, suggesting a feedback mechanism that modulates PRA1 signaling once the b program is activated . The b locus encodes homeodomain transcription factors that trigger G2 cell cycle arrest necessary for forming the infectious dikaryon, while proper PRA1 function is required for the initial recognition events .

How do allelic variations in pheromone receptors influence mating compatibility across smut fungi?

Allelic variations in pheromone receptors create sophisticated recognition systems that determine mating compatibility in smut fungi. In U. bromivora, diagnostic PCR approaches have identified both pra1 and pra2 alleles in spores, indicating that like other smut fungi, it employs a dual pheromone-receptor system . Interestingly, when testing progeny after spore germination, researchers identified only cells of mating type 1 (MAT-1), suggesting a mating type bias possibly linked to recessive alleles at the mating type locus . This phenomenon has been observed in related fungi and demonstrates how receptor variations influence population genetics . The highly specific interaction between pheromones and their cognate receptors creates a molecular barcode system ensuring appropriate partner recognition, while evolutionary divergence in receptor sequences likely contributes to reproductive isolation between fungal species.

What are effective strategies for overcoming PRA1 expression and purification challenges?

Purifying functional PRA1 requires strategies that address the challenges inherent to membrane protein biochemistry. First, expression systems should be selected that support proper membrane insertion and folding, with fungal expression systems often outperforming bacterial systems for maintaining receptor integrity. Second, solubilization protocols must be carefully optimized using detergents that maintain the native conformation of the seven-transmembrane domain structure. Third, affinity tagging approaches must balance purification efficiency with tag interference; N-terminal tags generally interfere less with function than C-terminal modifications for G protein-coupled receptors. Fourth, stabilization strategies such as ligand binding during purification can maintain the receptor in a functional state. Finally, functional validation through ligand binding assays using synthetic pheromones provides critical quality control to ensure the purified receptor maintains its biological activity.

How can researchers distinguish between direct and indirect effects when studying PRA1 function?

Distinguishing direct from indirect effects in PRA1 research requires multiple complementary approaches. Rescue experiments provide especially powerful evidence, as demonstrated when strong PRA1 expression rescued signaling defects in endocytosis mutants but could not restore subsequent cell fusion . This revealed that endocytosis impacts multiple pathways beyond just maintaining PRA1 levels. Domain swapping experiments, where specific receptor regions are exchanged between functional and non-functional variants, can pinpoint which domains directly mediate specific functions. Temporal control using inducible systems or temperature-sensitive mutations helps establish causality by revealing immediate versus delayed consequences of receptor manipulation . Finally, direct biochemical interaction studies using techniques like co-immunoprecipitation can identify immediate binding partners versus downstream effectors in the signaling cascade.

What approaches help resolve contradictory findings regarding PRA1 function in different experimental systems?

Resolving contradictory findings regarding PRA1 function requires systematic investigation of biological and technical variables. First, standardize experimental conditions across studies, particularly regarding strain backgrounds, as genetic modifiers can significantly alter receptor behavior. Second, implement parallel positive and negative controls when comparing different experimental systems to establish baseline responses. Third, conduct dose-response studies rather than single-point experiments, as different systems may have shifted sensitivity thresholds rather than fundamentally different responses. Fourth, examine the entire signaling pathway, as differences in downstream components might explain varied phenotypes despite similar receptor function. Finally, consider collaborative cross-laboratory validation studies where the same experimental protocols are implemented in different research environments to identify and control for laboratory-specific variables.

Table 1: Comparison of PRA1 Functions Across Developmental Stages

Developmental StagePRA1 FunctionEffects of Disrupted EndocytosisKey Regulatory Interactions
Pheromone PerceptionCell surface receptor for mating factorSeverely impaired recognition due to receptor depletion from membrane Initial activation of pheromone signaling cascade
Cell-Cell FusionRequired for recognition of compatible partnerCompletely blocked even with restored PRA1 signaling Preparation for dikaryon formation
Filament FormationInitiates signaling leading to filamentous growthReduced formation of conjugation hyphae Interacts with b-dependent regulation
Pathogenic DevelopmentInitiates cascade required for pathogenicityMultiple stages affected, with spore formation most severely impaired Regulated by Clp1 interaction with Rbf1
Spore FormationIndirect role through earlier developmental stagesDrastically reduced Integration with b-program through regulatory networks
Spore GerminationPossibly involved in sensing environmental cuesDrastically reduced Possibly linked to mating type bias in progeny

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.