Recombinant Uukuniemi virus Envelope glycoprotein (GP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Uukuniemi Virus Envelope Glycoprotein (GP)

Recombinant Uukuniemi virus envelope glycoproteins are proteins derived from the Uukuniemi virus, a member of the Bunyaviridae family. These glycoproteins, specifically Gn and Gc, play crucial roles in the virus's life cycle, including attachment to host cells and fusion with the host cell membrane. The recombinant versions of these proteins are engineered for research purposes, allowing scientists to study viral replication, assembly, and interaction with host cells in detail.

Structure and Function of Uukuniemi Virus Glycoproteins

Uukuniemi virus envelope glycoproteins consist of two main components: Gn (glycoprotein N) and Gc (glycoprotein C). Gn is primarily involved in receptor binding, while Gc acts as a fusion protein facilitating the entry of the virus into host cells . These glycoproteins form heterodimers, which are essential for viral assembly and budding .

Glycoprotein Structure and Assembly

GlycoproteinFunctionAssembly
GnReceptor bindingForms heterodimers with Gc
GcFusion proteinInner part of the glycoprotein shell

The Gn and Gc glycoproteins are synthesized in the endoplasmic reticulum (ER) and then transported to the Golgi apparatus, where they mature and assemble into virions . The cytoplasmic tails of these glycoproteins are crucial for intracellular targeting and budding of virus-like particles (VLPs) .

Recombinant Glycoproteins in Research

Recombinant Uukuniemi virus envelope glycoproteins are used in various research applications, including the generation of infectious VLPs. These VLPs can mimic the structure and function of authentic viruses, allowing for the study of viral replication and assembly without the need for live viruses .

Applications of Recombinant Glycoproteins

  1. Vaccine Development: Recombinant glycoproteins can serve as antigens for vaccine development, providing a safer alternative to live viruses.

  2. Viral Assembly Studies: They help in understanding how viral components assemble into infectious particles.

  3. Host-Virus Interaction: Recombinant glycoproteins facilitate the study of host-virus interactions, including receptor binding and membrane fusion.

Glycosylation Patterns of Uukuniemi Virus Glycoproteins

The glycosylation patterns of Gn and Gc glycoproteins are distinct and play a role in viral assembly and host cell interaction. Gn primarily contains complex-type glycans, while Gc is dominated by oligomannose-type glycans .

Glycosylation Patterns

GlycoproteinPredominant Glycosylation Type
GnComplex-type glycans
GcOligomannose-type glycans

These glycosylation patterns are important for the structural integrity and antigenic properties of the virions.

Role of Host Factors in Viral Assembly

Host factors, such as GBF1, are crucial for the replication and assembly of Uukuniemi virus. GBF1, a guanine nucleotide exchange factor, supports viral replication by facilitating the proper localization of viral glycoproteins within the Golgi apparatus .

Host Factors Involved in Viral Assembly

Host FactorRole in Viral Assembly
GBF1Facilitates glycoprotein localization in the Golgi

Inhibitors of GBF1, like Golgicide A, can block viral infection by disrupting this process .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GP; Envelopment polyprotein; M polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
514-1008
Protein Length
Full Length of Mature Protein
Species
Uukuniemi virus (strain S23) (Uuk)
Target Names
GP
Target Protein Sequence
CSDSISVTASSQRCSTSSDGVNSCFVSTSSLLQVSPKGQESCLILKGPTGTAVDSIRIKT TDIKLECVRRDLYWVPRVTHRCIGTRRCHLMGACKGEACSEFKINDYSPEWGHEEELMAQ LGWSYCVEQCGGALCQCFNMRPSCFYLRKTFSHLSQDAFNIYECSEWSYRINVLVSTNST HSNLTLKLGVPDSIPHGLISLSSVSQPPAIAYSECFGEDLHGTKFHTVCNRRTDYTLGRI GEIQCPTKADALAVSKRCISSDSIIFSKVHKDSVDCQSSIIDPMTIRNRNKLPSTVGSVT FWPTETSVEAAIPDLASATMLIRLDGYTIQFRSDSNKCSPRFLSLSGCYNCEAGAKLELE HVTDFGTALGILECPSLGYTTYYEVKNTLEKSIRTMHLNGSHVEAKCYFRCPNSESQLTI RGELIYLFNDDIRHHNQTLSPGLSPKSGSGWDPFGWFKASWLRAIWAILGGTVSLIIGVV IIYMVFTLCLKVKKS
Uniprot No.

Target Background

Function
Glycoproteins N and C, found on the virion surface, interact to mediate virion attachment to cell receptors and subsequent membrane fusion following virion endocytosis.
Database Links

KEGG: vg:2943072

Protein Families
Phlebovirus envelope glycoprotein family
Subcellular Location
[Glycoprotein N]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Glycoprotein C]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What are the structural characteristics of Uukuniemi virus envelope glycoproteins?

Uukuniemi virus contains two main envelope glycoproteins, GN and GC, which are translated as a common precursor encoded by the M genomic segment. This precursor undergoes cotranslational insertion into the endoplasmic reticulum (ER) membrane, where it is cleaved to form the individual GN and GC proteins. These proteins then form heterodimers, which are transported to the Golgi complex—the site of virus budding . The cytoplasmic tail of GN contains multiple functional domains, including regions critical for virus budding (encompassing residues 21-25) and regions important for ER exit and transport to the Golgi complex (residues 46-50) . The GC protein has a shorter cytoplasmic tail with a conserved lysine at position -3 from the C-terminus, which plays a crucial role in protein localization .

How do Uukuniemi virus glycoproteins influence viral assembly and budding?

Uukuniemi virus glycoproteins play central roles in viral assembly and budding processes. Research shows that expression of GN and GC alone is sufficient to initiate budding and generate infectious virus-like particles (VLPs) . The GN glycoprotein is particularly important as its cytoplasmic tail specifically interacts with ribonucleoproteins (RNPs) and is critical for genome packaging . Within the GN cytoplasmic tail, leucines at positions 23 and 24 are crucial for initiating VLP budding, while leucine 46, glutamate 47, and leucine 50 are important for efficient exit from the ER and subsequent transport to the Golgi complex . For proper virion formation, both glycoproteins must localize correctly within the cell, as mutations in the lysine residue of GC's cytoplasmic tail can cause mislocalization of both glycoproteins to the plasma membrane, compromising VLP generation .

What experimental approaches are used to study Uukuniemi virus glycoprotein functions?

The development of reverse genetics systems has significantly advanced the study of Uukuniemi virus glycoproteins. These systems allow researchers to recover UUKV entirely from cDNA clones and generate recombinant viruses with specific modifications . One important application has been the creation of virus-like particle (VLP) systems, which enable the investigation of functional motifs within the glycoprotein cytoplasmic tails . Additionally, researchers have developed GFP-expressing viruses that allow convenient monitoring of viral replication . For studying glycoprotein interactions with host factors, immunoprecipitation of viral nucleocapsid (NCAP) in infected cells has been employed to analyze the associations between viral ribonucleoproteins and cellular proteins . RNA-binding proteome (RBPome) analysis in infected tick cells has also been used to identify host proteins that interact with viral components, potentially including the glycoproteins .

How do glycosylation patterns of Uukuniemi virus glycoproteins differ between tick and mammalian cells?

The glycosylation profiles of Uukuniemi virus glycoproteins show significant host-dependent differences that may affect virus-host interactions. In tick cell-derived viral progeny, the GC glycoprotein is predominantly highly mannosylated . This contrasts with the glycosylation pattern observed in mammalian cells. The GN protein carries mostly N-glycans that are not recognized by classical glycosidases, suggesting unique glycosylation mechanisms in the tick host . These host-specific glycosylation patterns may enhance virus infectivity for mammalian cells following transmission from the tick vector . The distinct structural properties and N-glycans of tick-derived viral particles highlight the importance of considering the host switch when studying early virus-mammalian receptor/cell interactions . Researchers investigating these differences typically employ glycosidase treatments combined with Western blotting or mass spectrometry to characterize the glycan structures on virus particles produced in different host systems.

What is the significance of tick-mammal switch for Uukuniemi virus glycoprotein research?

The tick-mammal switch represents a critical transition in the natural transmission cycle of Uukuniemi virus, with important implications for glycoprotein research. Studies have shown that virions derived from tick cells possess specific structural properties and N-glycan modifications that may enhance virus infectivity for mammalian cells . These host-dependent differences underscore the importance of studying viral glycoproteins in both tick and mammalian systems to fully understand infection dynamics. The development of in vitro tick cell-based models that support UUKV production to high titers has enabled researchers to investigate these host-specific glycoprotein characteristics .

To properly study the tick-mammal switch, researchers should consider using both IRE/CTVM19 and IRE/CTVM20 cell lines derived from Ixodes ricinus (the natural tick reservoir for UUKV), which support persistent virus infection over many weeks . Comparative analyses of glycoprotein properties between tick cell-derived and mammalian cell-derived virions provide valuable insights into how these proteins adapt during cross-species transmission and initial infection of mammalian hosts .

How can reverse genetics approaches enhance the study of Uukuniemi virus glycoproteins?

Reverse genetics systems provide powerful tools for investigating Uukuniemi virus glycoproteins by enabling precise genetic manipulation of the viral genome. These systems allow researchers to recover UUKV entirely from cDNA clones and generate recombinant viruses with specific modifications to glycoprotein-encoding sequences . Such approaches have facilitated the creation of reporter viruses expressing GFP, which enable convenient monitoring of virus replication and glycoprotein functionality .

For implementing reverse genetics to study UUKV glycoproteins, researchers typically clone the M segment (encoding the glycoprotein precursor) into appropriate expression vectors, introduce desired mutations through site-directed mutagenesis, and recover recombinant viruses by transfecting cells with plasmids encoding all viral genomic segments . This approach has been successfully used to identify functional domains within glycoprotein cytoplasmic tails, such as regions critical for virus budding (residues 21-25) and ER exit (residues 46-50) .

Advanced applications include creating chimeric glycoproteins to map domain-specific functions or generating viruses with tagged glycoproteins to facilitate visualization and protein interaction studies. When designing such experiments, researchers should consider potential structural impacts of mutations on glycoprotein folding and heterodimer formation, as these can affect protein localization and virus assembly .

What host factors interact with Uukuniemi virus glycoproteins during infection?

Comprehensive analysis of host-virus interactions during Uukuniemi virus infection has revealed numerous cellular factors that may interact with viral glycoproteins. In tick cells, UUKV infection causes a pervasive remodeling of the RNA-binding proteome, with changes in RNA-binding activity for 283 proteins . While many of these interactions involve the viral nucleocapsid (NCAP), some may also engage with glycoproteins during the viral lifecycle.

Studies using immunoprecipitation of UUKV nucleocapsid in infected cells have identified host proteins that associate with viral complexes . For example, the TOP3B complex has been implicated in facilitating efficient packaging of UUKV virions, suggesting a potential interaction with glycoproteins during assembly . This is supported by the observation that knockdown of TOP3B did not affect viral RNA replication but resulted in decreased production of infectious virus particles .

To investigate these interactions, researchers can employ techniques such as co-immunoprecipitation with antibodies against viral glycoproteins, proximity labeling approaches, or mass spectrometry-based interactome analyses. RNA interference (RNAi) or CRISPR-Cas9 gene editing can then be used to validate the functional relevance of identified host factors, as demonstrated in tick cells where gene silencing affected viral particle production without altering RNA replication .

How do functional domains within glycoprotein cytoplasmic tails influence virus assembly?

The cytoplasmic tails of both GN and GC glycoproteins contain critical functional domains that orchestrate virus assembly through distinct mechanisms. In GN, the cytoplasmic tail encompasses multiple functional regions involved in different aspects of the virus lifecycle . The region spanning residues 21-25, particularly leucines at positions 23 and 24, is crucial for initiating virus budding . Another region (residues 46-50), including leucine 46, glutamate 47, and leucine 50, is essential for efficient exit from the ER and subsequent transport to the Golgi complex . Additionally, the C-terminal portion of the GN cytoplasmic tail mediates specific interactions with viral ribonucleoproteins, facilitating genome packaging into nascent virions .

For the GC glycoprotein, the short cytoplasmic tail contains a lysine at position -3 from the C-terminus that is highly conserved among members of the Phlebovirus, Hantavirus, and Orthobunyavirus genera . Mutation of this single amino acid residue results in mislocalization of both GC and GN to the plasma membrane, significantly compromising virus-like particle generation .

To experimentally investigate these domains, researchers typically introduce point mutations or small deletions into the cytoplasmic tail sequences, generate recombinant viruses or VLPs carrying these modifications, and assess their impact on protein localization, virus assembly, and infectious particle production . Immunofluorescence microscopy is commonly used to monitor protein localization, while virus titers and plaque assays quantify infectious particle production.

What are the optimal conditions for expressing recombinant Uukuniemi virus glycoproteins?

When expressing the glycoproteins, researchers should consider that GN and GC are normally processed from a polyprotein precursor. Therefore, expressing the complete M segment coding sequence rather than individual glycoproteins may yield more authentic processing and assembly . For purification purposes, addition of affinity tags like polyhistidine can facilitate isolation, though care must be taken to position tags where they won't interfere with protein folding or function .

Optimal expression conditions typically include transfection of cDNA constructs into cells, followed by incubation for 48-72 hours at temperatures appropriate for the host cell line (37°C for mammalian cells, lower temperatures for tick cells) . For purification, methods may include affinity chromatography under conditions that preserve protein structure, followed by buffer exchange into formulations that maintain stability .

How can RNA interference be effectively applied to study Uukuniemi virus glycoprotein functions in tick cells?

RNA interference (RNAi) represents a valuable approach for investigating the roles of both viral glycoproteins and interacting host factors in tick cells. Recent research has established robust methodology for silencing gene expression in tick cell cultures, which can be applied to study UUKV glycoprotein functions . For effective RNAi in tick cells, researchers typically synthesize long double-stranded RNA (dsRNA) targeting specific host genes or viral sequences through in vitro transcription .

The protocol involves treating tick cells with dsRNA (typically 5-10 μg per well in a 24-well plate) by directly adding it to the culture medium without transfection reagents . Multiple treatments, spaced 3-4 days apart, may be necessary to maintain gene silencing throughout the experiment. Knockdown efficiency should be verified by quantitative RT-PCR or Western blotting before proceeding with infection studies .

When applying RNAi to study glycoprotein functions, researchers have successfully knocked down host factors that interact with viral components, such as Ago2, XRN1, EIF3A, PABP1, and TOP3B, and then assessed the impact on viral replication and assembly . Using this approach, it was demonstrated that TOP3B knockdown did not affect viral RNA replication but significantly reduced the production of infectious virus particles, suggesting a role in virion assembly or release that may involve glycoprotein functions .

To comprehensively evaluate the effects of RNAi on glycoprotein-mediated processes, researchers should assess multiple parameters, including intracellular viral RNA levels, glycoprotein expression and localization, and the production of infectious particles over time .

How might structural studies of Uukuniemi virus glycoproteins inform antiviral development?

Detailed structural characterization of Uukuniemi virus glycoproteins holds significant potential for guiding the development of antivirals against emerging pathogenic phleboviruses. As UUKV serves as a model for more virulent relatives like severe fever with thrombocytopenia syndrome virus and Heartland virus, structural insights from this apathogenic model can inform therapeutic strategies without requiring high biosafety facilities .

Future research should focus on determining high-resolution structures of GN and GC using techniques such as cryo-electron microscopy and X-ray crystallography, with particular attention to receptor-binding domains and fusion mechanisms. Comparative structural analyses between UUKV and pathogenic phleboviruses could identify conserved epitopes for broad-spectrum antiviral development . Additionally, mapping glycosylation sites and their functional significance in both tick and mammalian cellular contexts may reveal important targets for intervention, as the unique glycan patterns of tick-derived virions appear to enhance mammalian cell infectivity .

Structure-guided drug design approaches could target critical interfaces within the glycoproteins or between glycoproteins and host factors. For example, compounds disrupting the interaction between the GN cytoplasmic tail and viral ribonucleoproteins might prevent genome packaging and virion formation . The established reverse genetics systems and virus-like particle models provide valuable platforms for screening candidate inhibitors and validating their mechanisms of action .

What technological advances would enhance our understanding of glycoprotein dynamics during infection?

Advancing our understanding of Uukuniemi virus glycoprotein dynamics during infection will require innovative technological approaches that capture the spatiotemporal complexity of virus-host interactions. Several promising directions include:

  • Live-cell imaging techniques: Development of non-disruptive fluorescent tagging methods for glycoproteins would enable real-time visualization of their trafficking, interactions, and conformational changes during infection. Building upon existing GFP-expressing virus systems , researchers could implement approaches such as split-GFP complementation or FRET-based sensors to monitor specific glycoprotein interactions with host factors.

  • Cryo-electron tomography: This technique could provide unprecedented structural insights into glycoprotein arrangement on virion surfaces and capture intermediate states during membrane fusion and budding events in near-native conditions.

  • Glycoproteomics: Advanced mass spectrometry approaches combined with targeted glycan analysis would further characterize the host-specific glycosylation patterns of GN and GC, particularly the unique N-glycans on tick-derived virions that are not recognized by classical glycosidases .

  • Proximity labeling methods: Techniques such as BioID or APEX2 fused to viral glycoproteins could map the dynamic interactome of GN and GC throughout the viral lifecycle, revealing transient interactions that may escape detection by conventional immunoprecipitation approaches.

  • Single-cell transcriptomics and proteomics: These approaches could reveal cell-to-cell variability in glycoprotein expression and host response during infection, potentially identifying cellular determinants of successful virus assembly and transmission.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.