Recombinant V-type proton ATPase 16 kDa proteolipid subunit 1 (vha-1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant vha-1 is expressed in heterologous systems with high purity (≥85–90%) for biochemical studies:

  • Expression Systems:

    • E. coli: Cost-effective for large-scale production but lacks post-translational modifications .

    • Yeast/Mammalian Cells: Retain eukaryotic folding and modification pathways .

  • Purification: SDS-PAGE-verified purity, often fused with His-tags for affinity chromatography .

Table 2: Production Parameters Across Host Systems

HostYield (mg/L)Purity (%)Advantages
E. coli5–20≥85High yield, low cost
Yeast2–10≥90Eukaryotic modifications
Mammalian Cells1–5≥90Native folding, functional assays

Functional Role in V-ATPase Activity

The recombinant subunit enables detailed mechanistic studies of V-ATPase:

  • Proton Translocation: Rotational movement of the proteolipid ring driven by ATP hydrolysis in the V₁ sector (VHA-A/B) .

  • ATPase Activity: Rates range from 4.32 to 18.7 µmol ATP hydrolyzed h⁻¹ mg⁻¹ protein, depending on redox state and isoform .

  • Cellular Functions:

    • Acidifies organelles (e.g., vacuoles, lysosomes) for protein degradation and ion homeostasis .

    • Facilitates endocytosis and neurotransmitter uptake in synaptic vesicles .

Research Applications

Recombinant vha-1 is pivotal in:

  • Enzyme Kinetics: Assessing inhibitor effects on proton transport (e.g., bafilomycin A1) .

  • Structural Biology: Cryo-EM studies resolving rotary mechanisms and subunit interactions .

  • Disease Models: Studying cancer metastasis linked to lysosomal pH dysregulation .

Key Research Findings

Recent studies highlight its regulatory diversity:

  • Isoform-Specific Localization:

    • VHA-a1 targets trans-Golgi networks (TGN), while VHA-a2/a3 localize to vacuoles in plants .

    • Human isoforms (e.g., ATP6V0C) show tissue-specific expression, with mutations linked to osteopetrosis .

  • Assembly Mechanisms: Requires chaperones (e.g., RAVE complex) for V₀-V₁ sector integration .

  • Redox Regulation: Cysteine residues in VHA-A modulate ATPase activity under oxidative stress .

Table 3: Notable Studies Using Recombinant vha-1

Study FocusKey InsightReference
Proton Channel DynamicsIdentified semi-helical proton pathways in V₀
Cancer MetastasisV-ATPase inhibition reduces invasiveness
Arabidopsis thalianaVHA-a1 knockout disrupts TGN pH homeostasis

Challenges and Future Directions

While recombinant vha-1 has advanced V-ATPase research, limitations persist:

  • Structural Flexibility: Dynamic conformations during rotation complicate crystallization .

  • Isoform Redundancy: Functional overlap among proteolipid isoforms remains poorly understood .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
vha-1; R10E11.8; V-type proton ATPase 16 kDa proteolipid subunit 1; V-ATPase 16 kDa proteolipid subunit 1; Vacuolar proton pump 16 kDa proteolipid subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
vha-1
Target Protein Sequence
MSTDTKQIIADALLKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARP DLVMKAIIPVVMAGIVAIYGLVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGA GYAIGIAGDAGVRALSQQPRMFVGMILILIFAEVLGLYGMIVALILGAT
Uniprot No.

Target Background

Function
This protein is the proton-conducting pore-forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying various intracellular compartments in eukaryotic cells. It is required, alongside other vacuolar ATPase components, for the removal of protein aggregates that form in immature oocytes in the distal gonad. This removal process occurs as the oocytes mature and migrate to the proximal gonad, is triggered by sperm introduction through mating, and takes place before fertilization. The introduction of sperm triggers V-ATPase accumulation in proximal oocytes and induces lysosomal acidification. This acidification leads to engulfment of protein aggregates by lysosomes, subsequently clearing the aggregates. Lysosomal acidification also influences mitochondrial morphology and function. Mitochondria in distal immature oocytes are fragmented, produce high levels of reactive oxygen species (ROS), and exhibit high membrane potential, indicative of metabolic inactivity. In contrast, mitochondria in proximal mature oocytes are tubular with lower ROS levels and membrane potential, indicating an active metabolic state necessary for aggregate mobilization prior to clearance. This protein plays a role in the processing and secretion of the aspartic protease hrg-7 from the intestine.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Tissue Specificity
Adult H-shaped excretory cell and rectum.

Q&A

What is the V-type proton ATPase and what role does the 16 kDa proteolipid subunit play?

The V-type proton ATPase (V-ATPase) is a dominant proton pump in cellular systems that contributes to cytosolic pH homeostasis and energizes transport processes across endomembranes . The enzyme consists of two main sectors: the peripheral V₁ sector responsible for ATP hydrolysis and the membrane-embedded V₀ sector that facilitates proton translocation. The 16 kDa proteolipid subunit 1 (vha-1) is a critical component of the V₀ sector's proteolipid cylinder, which forms a ring-like structure within the membrane . This proteolipid ring is essential for both the proton pumping function and the secondary role of V₀ in membrane fusion events in certain cellular pathways .

How is the proteolipid subunit organized within the V-ATPase complex?

The proteolipid subunits form a hexameric cylinder within the V₀ sector of the V-ATPase complex . This cylinder is anchored to the membrane and interacts with other V₀ components, particularly subunit VHA-a . The V₁ sector attaches to this V₀ complex through a rigid structure composed of three vertical peripheral stalks formed by elongated subunits VHA-E and VHA-G, which are crosslinked by horizontally oriented VHA-C and VHA-H . The entire assembly creates a rotary mechanism where ATP hydrolysis in V₁ drives rotation of the central stalk, which in turn causes rotation of the proteolipid ring to facilitate proton transport across the membrane.

What are the most effective purification strategies for recombinant vha-1?

Given that vha-1 is a hydrophobic membrane protein, purification typically follows a multi-step approach:

  • Membrane Fraction Isolation: After cell lysis, separate membrane fractions using differential centrifugation

  • Detergent Solubilization: Solubilize membranes using appropriate detergents (DDM, CHAPS, or digitonin)

  • Affinity Chromatography: Purify tagged protein using Ni-NTA (for His-tagged proteins) or other affinity resins

  • Size Exclusion Chromatography: Remove aggregates and further purify protein based on size

  • Ion Exchange Chromatography: Achieve higher purity based on protein charge properties

For structural studies, maintaining the native conformation is critical, so milder detergents or amphipols may be used during purification. The purification protocol must be optimized to balance yield with maintenance of protein activity.

How can researchers assess the functional activity of recombinant vha-1?

Several methods can be employed to assess the functionality of recombinant vha-1:

MethodMeasurementAdvantagesLimitations
Proton Pumping AssaypH changes using fluorescent probesDirect measure of functionRequires reconstitution
ATPase Activity AssayPhosphate release from ATPQuantitative, high-throughputIndirect measure for vha-1
Reconstitution in LiposomesProton gradient formationMimics native environmentComplex procedure
Binding AssaysInteraction with other V-ATPase subunitsEvaluates assembly capabilityDoesn't confirm function
Thermal Stability AssaysProtein unfolding temperatureFast screening methodIndirect functional measure

When testing vha-1 functionality, it's important to remember that the proteolipid alone may not exhibit proton pumping activity without proper assembly with other V₀ and V₁ components .

What mutagenesis approaches are most informative for studying vha-1 function?

Strategic mutagenesis of vha-1 has provided significant insights into its function. Key approaches include:

  • Alanine Scanning Mutagenesis: Systematically replacing residues with alanine to identify essential amino acids

  • Site-Directed Mutagenesis: Targeting specific residues based on conservation or predicted functional importance

  • Conservative vs. Non-conservative Substitutions: Evaluating the importance of particular properties (charge, hydrophobicity)

  • Cysteine Mutagenesis: Introducing cysteines for crosslinking studies or fluorescent labeling

  • Deletion and Truncation Mutants: Identifying essential regions for assembly and function

Research has shown that critical residues in proteolipid subunits concentrate within the bilayer, particularly near the subunit interfaces of the ring . Mutations that preserve proton translocation but impair membrane fusion functions have been particularly valuable in distinguishing between the dual roles of V₀ .

How does vha-1 contribute to membrane fusion independently of its proton pumping function?

The V₀ sector, including vha-1, has been implicated in membrane fusion in the endocytic and late exocytic pathways, independent of its proton pumping activity . This function is particularly noteworthy as it represents a separate biological role from the canonical proton pump function.

Studies using mutagenesis approaches have identified specific residues in the proteolipid subunits that, when altered, preserve proton translocation but impair lipid and content mixing during membrane fusion events . These critical residues concentrate within the bilayer region, close to the interfaces between proteolipid ring subunits . The current model suggests that SNARE proteins induce a conformational change in the V₀ proteolipid cylinder, creating a hydrophobic crevice that promotes lipid reorientation and formation of a lipidic fusion pore .

This dual functionality highlights the evolutionary adaptation of V-ATPase components for multiple cellular roles and provides important insights for researchers designing experiments to distinguish between these functions.

What are the current technical challenges in structural studies of recombinant vha-1?

Structural studies of vha-1 face several significant challenges:

  • Membrane Protein Crystallization: Like many membrane proteins, obtaining well-diffracting crystals of vha-1 for X-ray crystallography remains difficult due to its hydrophobic nature and need for detergents

  • Maintaining Native Conformation: Ensuring the recombinant protein maintains its native fold during purification and analysis

  • Assembly with Other Subunits: Understanding vha-1 in the context of the complete V₀ sector, as its structure may differ when isolated versus assembled

  • Dynamic Conformations: Capturing different functional states, particularly those involved in the rotation mechanism

  • Heterogeneity: Dealing with structural heterogeneity that may arise from different lipid environments or associated proteins

How do regulatory mechanisms affect vha-1 within the V-ATPase complex?

The V-ATPase complex undergoes sophisticated regulation, including reversible dissociation of V₁ from V₀ sectors in response to cellular conditions . In yeast, this disassembly is triggered by glucose depletion and is controlled by the glucose-sensitive signaling pathway involving Ras-GTPases, Ira1p, Ira2p, cAMP, and phosphorylation by protein kinase A (PKA) .

During disassembly, the central pore becomes arrested by the N-terminal domain of VHA-a, preventing rotation of the proteolipid ring and blocking passive proton transport . The rotation of the central stalk and ATP hydrolysis are inhibited by the C-terminal half of VHA-H, which interacts with VHA-D and VHA-F in the central stalk .

For researchers studying vha-1 regulation, it's essential to consider these complex interactions, as the functionality of individual proteolipid subunits cannot be separated from the regulatory mechanisms affecting the entire complex.

How conserved is vha-1 across different species and what does this reveal about its function?

The proteolipid subunits of V-ATPase are highly conserved across eukaryotes, reflecting their fundamental importance in cellular physiology. Comparative analysis reveals:

  • Core Structure Conservation: The transmembrane helices that form the proteolipid ring show high sequence conservation

  • Functional Residues: The glutamate residue essential for proton translocation is invariant across species

  • Subunit Number Variation: While the basic structure is conserved, the number of gene copies encoding proteolipid subunits varies between organisms

  • Isoform Specialization: Some organisms have developed tissue-specific isoforms with specialized functions

In Arabidopsis thaliana, while some V-ATPase subunits like VHA-A, VHA-C, VHA-D, VHA-F, and VHA-H are encoded by single-copy genes and represent highly conserved components, others like VHA-B, VHA-E, and VHA-G exist as multiple isoforms, providing flexibility in V₁-sector formation . This evolutionary pattern suggests that vha-1, as part of the conserved core, likely performs essential functions that cannot tolerate significant variations.

What are the key differences between vha-1 in plant versus animal systems?

Plant and animal V-ATPase systems share the same basic architecture but exhibit important differences:

FeaturePlant SystemsAnimal Systems
Tissue ExpressionOften shows tissue-specific patterns; VHA-E1 is prominent during embryogenesis in A. thalianaCan have tissue-specific isoforms with specialized functions
RegulationResponds to environmental stresses like salt, droughtPrimarily regulated by nutrient availability
Subcellular LocalizationProminent in vacuole membrane (tonoplast)Primarily in lysosomes, endosomes, and specialized secretory vesicles
Disassembly DynamicsMay be less prone to glucose-dependent disassemblyIn mammals, V-ATPases appear "primed" for disassembly
Associated ProteinsPlant-specific regulatory partnersAnimal-specific regulatory partners

These differences reflect the adaptation of V-ATPase systems to the unique physiological requirements of plant versus animal cells. For researchers, these distinctions are critical when extrapolating findings between systems or designing comparative studies.

How can genetic manipulation of vha-1 be used to study cellular pH regulation?

Genetic manipulation of vha-1 offers powerful approaches to understand cellular pH regulation:

  • Conditional Knockdowns/Knockouts: Using inducible systems to reduce or eliminate vha-1 expression and observe effects on pH homeostasis

  • Point Mutations: Introducing specific mutations that alter proton pumping efficiency without completely abolishing function

  • Fluorescent Tagging: Creating vha-1-fluorescent protein fusions to track localization during pH changes

  • Chimeric Constructs: Swapping domains between vha-1 variants from different species to identify pH-regulatory regions

  • Overexpression Studies: Examining consequences of enhanced V-ATPase activity on cellular pH and related processes

Researchers should carefully distinguish between direct effects on proton pumping versus secondary effects on membrane fusion capabilities . Combinations of these approaches with real-time pH monitoring using fluorescent probes can provide comprehensive insights into the role of vha-1 in cellular pH regulation.

What methods are most effective for studying vha-1 assembly into the V₀ sector?

Several complementary approaches can be employed to study vha-1 incorporation into the V₀ sector:

  • Co-immunoprecipitation: Pulling down vha-1 and identifying associated V₀ components

  • Blue Native PAGE: Analyzing intact V₀ complexes to determine assembly state

  • Förster Resonance Energy Transfer (FRET): Measuring proximity between fluorescently labeled vha-1 and other V₀ subunits

  • Crosslinking Studies: Chemically or photochemically crosslinking vha-1 to interacting partners

  • Mass Spectrometry: Identifying protein-protein interactions and post-translational modifications that regulate assembly

Assembly research should consider that subcomplexes such as VHA-E/VHA-G, which may represent intermediate assembly states, might be building blocks for V₁-sector assembly . The RAVE complex (consisting of Rav1p, Rav2p, and Skp1p in yeast) supports assembly of V₁ with V₀ and is particularly important for incorporating VHA-C into the complex and ensuring proper orientation of the sectors .

How can researchers distinguish between the proton pumping and membrane fusion functions of vha-1?

Differentiating between the dual functions of vha-1 requires strategic experimental approaches:

  • Targeted Mutagenesis: Generate mutations that specifically impair one function while preserving the other, as demonstrated in studies where certain proteolipid mutations preserved proton translocation but impaired lipid and content mixing

  • Function-Specific Assays:

    • Proton pumping: ATP-dependent pH gradient formation

    • Membrane fusion: Lipid mixing and content mixing assays

  • Reconstitution Systems: Creating proteolipid-containing liposomes to test fusion activity independent of intact V-ATPase complexes

  • Inhibitor Studies: Using specific inhibitors of V-ATPase proton pumping (e.g., bafilomycin A) while monitoring fusion events

  • Structural Analysis: Examining conformational changes in vha-1 during different functional states using approaches like hydrogen-deuterium exchange mass spectrometry

These approaches can help clarify how the hexameric proteolipid cylinder might support membrane fusion independently of its role in proton pumping, potentially by creating hydrophobic crevices that promote lipid reorientation and formation of lipidic fusion pores .

What strategies can overcome low expression yields of recombinant vha-1?

Low expression yields are common with membrane proteins like vha-1. Consider these strategies:

  • Expression System Optimization:

    • Try different host strains (BL21, C41/C43 for E. coli)

    • Adjust induction conditions (temperature, inducer concentration, timing)

    • Use specialized vectors with strong promoters for membrane proteins

  • Fusion Partners:

    • Maltose-binding protein (MBP)

    • Thioredoxin (Trx)

    • Glutathione S-transferase (GST)

  • Growth Conditions:

    • Lower growth temperature (16-20°C)

    • Modified media composition

    • Consider auto-induction media

  • Codon Optimization:

    • Adapt coding sequence to expression host preferences

    • Address rare codons that may limit expression

  • Co-expression Strategies:

    • Include chaperones to assist folding

    • Co-express with other V₀ components to promote stability

Successful expression often requires systematic optimization and may benefit from combining multiple strategies tailored to the specific properties of vha-1.

How can researchers address proteolipid aggregation during purification and analysis?

Membrane protein aggregation is a common challenge that can be addressed through several approaches:

  • Detergent Screening:

    • Test multiple detergent types (DDM, LMNG, CHAPS)

    • Try detergent mixtures for improved solubilization

    • Consider newer amphipathic agents like SMA copolymers

  • Buffer Optimization:

    • Adjust pH, ionic strength, and glycerol content

    • Add stabilizing agents (specific lipids, cholesterol)

    • Include low concentrations of reducing agents

  • Purification Strategy:

    • Implement on-column detergent exchange

    • Use size exclusion chromatography to remove aggregates

    • Consider density gradient centrifugation for separation

  • Temperature Management:

    • Maintain samples at 4°C throughout purification

    • Avoid freeze-thaw cycles

    • Use controlled cooling/heating rates

  • Alternative Approaches:

    • Reconstitute into nanodiscs or liposomes

    • Try bicelles or lipid cubic phases for structural studies

    • Consider protein engineering to improve stability

The choice of approach depends on the intended application, with structural studies requiring higher purity and homogeneity than functional assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.