Recombinant V-type proton ATPase 16 kDa proteolipid subunit (VMA3)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

Recombinant VMA3 has been expressed in multiple systems to study its role in V-ATPase assembly and activity:

Host SystemConstructTagFunctional ValidationSource
E. coliFull-length (1-177 aa)N-terminal HisUsed for biochemical assays and structural studies
S. cerevisiaeComplementation of ΔVMA3 strainsHA tagRestored proton transport and ATPase activity
Cell-freeTransmembrane domains (1-160 aa)NoneConfirmed α-helical structure in lipid membranes

Functional studies in yeast show that recombinant VMA3 restores vacuolar acidification in ΔVMA3 strains, as demonstrated by fluorescence quenching assays .

Complementation Studies

  • Acetabularia cDNAs: Four out of six Acetabularia-derived VMA3 homologs successfully complemented ΔVMA3 yeast, restoring proton transport and cross-reacting with anti-V-ATPase antibodies .

  • Gene fusions: Constructs like c-c″(ΔTM1) and c′-c restored >25% ATPase activity in yeast, confirming the flexibility of subunit arrangement in the proteolipid ring .

Role in Cellular Physiology

  • Vacuolar fragmentation: Mutations in VMA3 alter vacuolar morphology, with specific alleles increasing vacuole copy numbers in yeast .

  • Proton channel function: The recombinant subunit forms a pore capable of sustaining ATP-dependent proton translocation, as shown by ACMA fluorescence quenching .

Applications in Research

  • Mechanistic studies: Used to probe V-ATPase assembly and rotary mechanics .

  • Disease models: Linked to neurodegenerative disorders and cancer via its role in lysosomal pH regulation .

  • Drug discovery: Targeted by inhibitors like concanamycin A to study pH-dependent cellular processes .

Future Directions

  • Structural resolution: Cryo-EM studies of recombinant VMA3 could elucidate conformational changes during proton transport.

  • Gene editing: Drosophila and Manduca models with Vha16 (VMA3 homolog) mutations may reveal dual roles in gap junctions and ATPase activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill them as requested.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
VMA3; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Entamoeba dispar
Target Names
VMA3
Target Protein Sequence
MSVLLRSVTELCPVYSPFFGSMGITASIVFTVFGGAYGTAKSSVGISSVGVMKPEFIMRS LFPVVFAGVIGLYGLIVCIVLFINVNKSEYSLNRAFLDLGAGLTCGLCGLASGMSIGISG DCGVRGAAQQPKLFVSMLICLIFSEALALYGFIVALIMAATGDNSCVATASTSSSS
Uniprot No.

Target Background

Function
The 16 kDa proteolipid subunit (VMA3) is a proton-conducting pore-forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying various intracellular compartments in eukaryotic cells.
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is VMA3 and what is its role in the V-ATPase complex?

VMA3 is a structural gene that encodes subunit c of the vacuolar membrane H⁺-ATPase (V-ATPase) in organisms such as Saccharomyces cerevisiae. The gene product is a hydrophobic polypeptide consisting of 160 amino acids that lacks N-terminal methionine and does not have a cleavable signal sequence . This proteolipid subunit plays a crucial role in the V₀ domain of the V-ATPase complex, which is responsible for proton transport across the membrane.

In the V-ATPase structure, the VMA3-encoded subunit c forms part of a six-membered proteolipid ring in the V₀ domain. Specifically in yeast, this ring contains four copies of subunit c (encoded by VMA3), one copy of subunit c' (encoded by VMA11), and one copy of subunit c" (encoded by VMA16) . This arrangement is essential for the proton translocation function of the V-ATPase complex.

What phenotypes are observed when VMA3 is disrupted in model organisms?

Disruption of the VMA3 gene leads to several significant phenotypic changes:

  • Complete loss of vacuolar membrane H⁺-ATPase activity

  • Inability to acidify the vacuole in vivo

  • Considerable lesions in vacuolar biogenesis

  • Impaired protein transport to the vacuole

  • Inhibition of endocytosis

In Candida albicans, repression of VMA3 causes additional phenotypes including:

  • pH-dependent growth defects

  • Calcium sensitivity

  • Cold sensitivity

  • Abnormal vacuolar morphology

  • Impaired aspartyl protease and lipase secretion

  • Suppressed filamentation

  • Attenuated virulence in infection models

These phenotypes highlight VMA3's essential role in V-ATPase function and broader cellular processes.

What approaches can be used to generate and study VMA3 mutants?

Several complementary approaches have been employed to generate and study VMA3 mutants:

  • Gene disruption techniques:

    • Homologous recombination to create complete knockouts

    • Insertion of marker genes to disrupt the VMA3 locus

  • Conditional expression systems:

    • Tetracycline-regulatable promoters (tetR-VMA3 strains) that allow controlled repression of VMA3 expression

    • This approach is particularly valuable for studying essential genes or time-dependent effects

  • Site-directed mutagenesis:

    • Targeted mutation of specific residues (e.g., the conserved glutamic acid residue critical for proton translocation)

    • Creation of fusion constructs to constrain the arrangement of proteolipid subunits in the ring

When designing VMA3 mutation studies, researchers should consider:

  • The genetic background of the host strain

  • Appropriate selection markers

  • Verification methods (PCR, Southern blotting, Western blotting)

  • Phenotypic assays to confirm the expected functional consequences

How can I measure V-ATPase activity and vacuolar acidification in VMA3 mutants?

Multiple complementary approaches can be used to assess V-ATPase function in VMA3 mutants:

Table 3.1: Methods for Measuring V-ATPase Activity

MethodMeasurementAdvantagesLimitations
ATPase activity assayConcanamycin A-sensitive ATPase activityQuantitative, direct measure of enzymatic functionRequires isolated membranes, potential contamination from other ATPases
Proton transport assayRate of proton translocation across membranesDirectly measures transport functionTechnical complexity, requires specialized equipment
Vacuolar pH measurementIn vivo vacuolar pH using fluorescent dyesAssesses physiological function in living cellsPotential artifacts from dye loading, calibration challenges
Protein assembly analysisAssembly of V-ATPase subunitsEvaluates structural consequences of mutationsDoes not directly measure enzymatic activity

In typical experiments, researchers have observed that VMA3 disruption reduces concanamycin A-sensitive ATPase-specific activity and proton transport by more than 90%, confirming its essential role in V-ATPase function .

What methods are effective for studying the arrangement of VMA3 within the proteolipid ring?

Understanding the structural arrangement of VMA3 in the proteolipid ring requires specialized approaches:

  • Gene fusion constructs:

    • Creating fusion proteins that constrain the arrangement of pairs of subunits within the ring

    • For fusions involving subunit c" (Vma16p), researchers have used a truncated version lacking the first transmembrane helix to ensure proper orientation of N and C termini

  • Crosslinking studies:

    • Chemical or photo-crosslinking to identify adjacent subunits within the ring

    • Analysis of crosslinked products by mass spectrometry or immunoblotting

  • Structural biology techniques:

    • Cryo-electron microscopy to visualize the V-ATPase structure

    • X-ray crystallography of isolated V₀ domains or reconstituted proteolipid rings

  • Functional complementation assays:

    • Testing whether specific arrangements of proteolipid subunits can support V-ATPase function

    • Analysis of growth phenotypes and enzymatic activities in strains expressing various fusion constructs

These approaches have revealed that the proteolipid ring contains a specific arrangement of subunits c, c', and c" that is critical for function .

How does VMA3 contribute to V-ATPase assembly and what are the structural determinants?

VMA3 plays a critical role in V-ATPase assembly. Research has shown that:

  • The subunit c encoded by VMA3 is indispensable for the assembly of subunits a and b of the H⁺-ATPase complex

  • In the absence of VMA3, the V₁ and V₀ domains fail to properly associate, indicating that the proteolipid ring is a prerequisite for complex assembly

  • The transmembrane domains of VMA3 likely provide critical interaction surfaces for other V-ATPase subunits

To investigate the structural determinants of VMA3 in V-ATPase assembly, researchers can employ:

  • Systematic mutagenesis to identify critical residues or domains

  • Protein-protein interaction studies (Y2H, co-IP, FRET) to map interaction interfaces

  • Comparative analysis of VMA3 sequences across species to identify conserved regions likely important for function

  • Assembly kinetics studies to determine the temporal sequence of V-ATPase component incorporation

Understanding these assembly processes is crucial for developing comprehensive models of V-ATPase biogenesis and function.

How does VMA3-dependent vacuolar acidification impact virulence in pathogenic fungi?

VMA3 function has significant implications for virulence in pathogenic fungi like Candida albicans:

  • Filamentation: Repression of VMA3 suppresses filamentation, a key virulence trait. Interestingly, this defect cannot be rescued by overexpression of positive filamentation regulators (RIM8, MDS3, EFG1, CST20, or UME6), suggesting V-ATPase functions either downstream of these regulators or through independent mechanisms .

  • Secreted virulence factors: VMA3 disruption impairs secretion of aspartyl proteases and lipases, which are important for host tissue invasion and nutrient acquisition .

  • Macrophage interactions: The tetR-VMA3 strain shows attenuated virulence in an in vitro macrophage killing model, indicating compromised ability to survive host immune responses .

  • Stress adaptation: V-ATPase activity likely contributes to adaptation to host environments through pH homeostasis and stress response pathways.

These findings suggest that V-ATPase function, dependent on VMA3, represents a fundamental requirement for several key virulence-associated traits in pathogenic fungi, positioning it as a potential target for antifungal development.

What is the relationship between VMA3 function and membrane fusion events?

Beyond its role in vacuolar acidification, research suggests V₀ domain components like VMA3 may have acidification-independent roles in membrane fusion:

  • Studies across multiple organisms have implicated the V₀ domain in processes such as:

    • Yeast vacuolar fusion

    • Hedgehog secretion in C. elegans

    • Insulin secretion in mice

    • Phagosomal fusion in zebrafish

    • Vesicle fusion with endosomes in Drosophila neurons

  • In Drosophila, mutations in the V₀ subunit a1 (Vha100-1) that abolished proton translocation still partially rescued synaptic transmission defects, suggesting a proton transport-independent role in membrane fusion .

  • The proteolipid ring might serve as a structural component that facilitates membrane merger during fusion events.

How should I analyze and interpret data from VMA3 mutation studies?

When analyzing data from VMA3 mutation studies, consider these methodological approaches:

  • For biochemical assays:

    • Calculate specific activities (nmol/min/mg protein)

    • Determine V-ATPase-specific contribution by comparing activities with and without specific inhibitors (e.g., concanamycin A)

    • Express mutant activities as percentages of wild-type levels

    • Apply appropriate statistical analyses (t-tests, ANOVA) to determine significance

  • For phenotypic analyses:

    • Quantify growth rates under various conditions (pH, temperature, calcium levels)

    • Measure vacuolar pH in populations of cells using calibrated fluorescent indicators

    • Assess protein localization and trafficking using quantitative microscopy

    • Document morphological defects with standardized scoring systems

  • For genetic interaction studies:

    • Construct double mutants and apply epistasis analysis principles

    • Use rescue experiments to establish functional relationships

    • Employ synthetic genetic arrays to identify genes with related functions

Table 5.1: Expected Results in VMA3 Mutation Studies

ParameterWild-Typevma3ΔPartial VMA3 Mutant
V-ATPase activity100%<10%Variable (10-90%)
Vacuolar pH~6.2~7.0Intermediate
Growth at pH 7.5NormalSeverely impairedModerately impaired
Calcium sensitivityResistantHighly sensitiveModerately sensitive
Protein transport to vacuoleNormalDefectivePartially defective

This framework allows systematic interpretation of mutant phenotypes relative to controls.

What controls should be included when studying VMA3 function?

Robust experimental design for VMA3 studies requires several critical controls:

  • Genetic controls:

    • Wild-type parental strain

    • Complemented mutant strain (vma3Δ + VMA3) to confirm phenotype specificity

    • Known V-ATPase mutants affecting different subunits (e.g., vma2Δ, vma11Δ) for comparison

    • Unrelated vacuolar mutants to distinguish general vacuolar defects

  • Pharmacological controls:

    • V-ATPase inhibitors (bafilomycin A1, concanamycin A) to phenocopy vma3 mutations

    • Compounds that alter vacuolar pH independently of V-ATPase

    • Vehicle controls for all chemical treatments

  • Experimental condition controls:

    • pH range tests (typically pH 5.5-8.0) to capture conditional phenotypes

    • Temperature sensitivity assays (typically 16°C, 30°C, 37°C)

    • Media complexity variations (rich vs. minimal media)

  • Technical controls:

    • Multiple independent transformants for each construct

    • Time-course analyses to distinguish primary from secondary effects

    • Internal standards for biochemical assays

Implementing these controls ensures that observed phenotypes can be specifically attributed to VMA3 function rather than secondary effects or technical artifacts.

How might VMA3 research inform therapeutic strategies for fungal infections?

VMA3 research has significant potential to inform antifungal therapeutic development:

  • Target validation:

    • Studies in C. albicans demonstrate that V-ATPase function is essential for multiple virulence traits

    • The attenuated virulence of VMA3-deficient strains supports V-ATPase as a viable antifungal target

  • Structural insights for drug design:

    • Understanding the arrangement of proteolipid subunits in the ring can guide structure-based drug discovery

    • Identification of fungal-specific features of VMA3 could enable selective targeting

  • Combination therapy approaches:

    • VMA3/V-ATPase inhibition could sensitize fungi to existing antifungals

    • Targeting multiple aspects of pH homeostasis might prevent resistance development

  • Diagnostic applications:

    • V-ATPase activity measurements could serve as biomarkers for fungal virulence

    • Molecular typing based on VMA3 sequence variations might predict treatment response

Future research should focus on developing high-throughput screening methods for compounds that specifically disrupt fungal V-ATPase function without affecting human homologs, potentially yielding novel therapeutic agents for treating fungal infections.

What emerging technologies might advance VMA3 research?

Several cutting-edge technologies hold promise for deepening our understanding of VMA3 function:

  • Cryo-electron microscopy advances:

    • High-resolution structural determination of the entire V-ATPase complex

    • Visualization of conformational changes during the catalytic cycle

    • Structures of VMA3 mutants to understand functional defects

  • Single-molecule approaches:

    • FRET-based sensors to monitor V-ATPase assembly and disassembly dynamics

    • Single-molecule tracking to study VMA3 movement and incorporation into complexes

    • Optical tweezers to measure forces during proton pumping

  • Genome editing technologies:

    • CRISPR-Cas9 for precise modification of VMA3 in various model systems

    • Base editors for introducing specific point mutations without double-strand breaks

    • Conditional degron systems for rapid protein depletion studies

  • Systems biology approaches:

    • Multi-omics integration to understand global cellular responses to VMA3 disruption

    • Metabolic flux analysis to characterize the impact on energy homeostasis

    • Network modeling to predict therapeutic targets and resistance mechanisms

These technologies promise to reveal new aspects of VMA3 biology that could lead to novel therapeutic strategies and deeper understanding of V-ATPase function across biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.