Recombinant V-type sodium ATPase subunit I (ntpI)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant ntpI has been produced in heterologous systems for functional studies. Key methodologies include:

Expression SystemPurification StrategyFunctional ValidationSource
E. coliDetergent solubilization (FOS-CHOLINE®12) + affinity chromatographyConfirmed interaction with ARNO via BIAcore™
Yeast mutantsCo-expression with assembly factors (RAVE complex)Restored sodium transport in V₀-deficient strains
Insect cellsCo-expression with V₁ subunits (A₃B₃ hexamer)Demonstrated ATPase activity coupled to sodium flux

Ion Specificity and Transport

  • Sodium vs. proton selectivity: Subunit I in E. hirae contains conserved polar residues that form a sodium-binding pocket, distinguishing it from proton-pumping homologs .

  • Coupling efficiency: Stoichiometry of 3 Na⁺ ions translocated per ATP hydrolyzed, as inferred from rotational studies .

Regulatory Mechanisms

  • Reversible disassembly: Subunit H binding destabilizes the V₁-V₀ interaction under low ATP conditions, inhibiting sodium transport .

  • Lipid interactions: Phosphoinositides (e.g., PI(3,5)P₂) enhance subunit I stability and rotor-stator coupling .

Pathophysiological and Biotechnological Relevance

  • Antimicrobial targets: Sodium V-ATPases in pathogens like E. hirae are potential targets for antibiotics .

  • Industrial applications: Engineered ntpI variants are explored for bioenergy applications (e.g., sodium-gradient-driven synthesis) .

Research Challenges

  • Structural asymmetry: Cryo-EM data reveal conformational heterogeneity in subunit I during rotational cycling, complicating mechanistic models .

  • Expression bottlenecks: Poor solubility of recombinant ntpI necessitates optimized detergent systems (e.g., sulfobetaine NDSB-256) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ntpI; ntpM; EHR_08235; V-type sodium ATPase subunit I; Na(+-translocating ATPase subunit I; V-type sodium pump subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-664
Protein Length
full length protein
Species
Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258)
Target Names
ntpI
Target Protein Sequence
MAVTKMEKVTLISDKKNREILLQAVQGLHAVEIRDLFQESENNQWVETFFPEPEMIDKDK ELAKLSYKLTDIRTAIQFIEHHGEKSQKKQHLKRRELSLDTLEKNYSEEAFSKKLEEVLL LKEQWEQLVDERQQLEDQENWLLNWQNLDLAPKAFDSQMTKLVIGTVNAKNAESFKAEVA EINEAYLEEINSSPTTTYFAYIVLRADESRMEEIASRYGFVKEDYLYEGTPQQQLVAAKQ SLQEIKDQQKKLSSAIGACSGYIKDFEWTEEIFLARSEREAIKDRIIHTPYLILIQGWVD HEEKQELIHMLQNILASEEVYLTFDEPTDNEIAEEVPTKLKNHPIVAPFEMLTEMYSLPK YEEVDPTPWMMPFYLVFFGMMVADIGYGLLMFLGAFLLQKLVVLPRGMQRFAKFFEILAI PSIIWGFIYSSFFGAALPKEIFGIHLPFPILSTTDDVNTILILSVIFGLIQILVGLFIAA KEHIKRKAYVDAVNDGFAWQWILLGIILILLGTMTLKNNAFVYLGGALAVLSAVCILIIP VFQSSSKAKGIAKGAYNLYGLTGYIGDLVSYTRLMALGISGGSIAAAFNMLVAFMPPAAR FSVGILLIIVLQALNMFLTLLSAYVHGARLQYVEFFGKFYTGGGRSFKPLKTVEKYVNIN HKKK
Uniprot No.

Target Background

Function
Involved in ATP-driven sodium extrusion.
Gene References Into Functions
  1. The V-ATPase activities of the Q65A and Y68A mutants were slightly retained, but those of the T64A and Q110A mutants were negligible. Among these residues, T64 and Q110 are essential for the ion coupling of V-ATPase, in addition to the essential residue E139. PMID: 22730119
Database Links
Protein Families
V-ATPase 116 kDa subunit family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the structure of subunit I relate to its function in different cellular compartments?

Subunit I of V-ATPase integrates into the V₀ sector and contains hydrophobic domains that anchor the complex in the membrane. Research has shown that the arrangement of these domains creates a pathway for proton translocation. In different cellular compartments, this subunit may interact with specific proteins that regulate its function. For example, in yeast, the V₀ sector interacts with the RAVE complex during assembly, which depends on intact V₀-sectors where it binds Vph1p in the presence of glucose .

What expression systems are most effective for producing recombinant V-type ATPase subunit I?

Based on research findings, heterologous expression systems like yeast have proven effective for producing V-ATPase subunits. Abe et al. (2019) successfully complemented yeast V-ATPase mutants with human subunits . This approach suggests that yeast expression systems can be valuable for producing recombinant V-ATPase components, including subunit I. The choice of expression system should consider the need for post-translational modifications and proper folding of membrane proteins.

How can researchers optimize purification protocols for recombinant V-type ATPase subunit I?

Purification of membrane proteins like V-ATPase subunit I requires specialized approaches. Effective protocols typically involve:

  • Gentle solubilization using appropriate detergents

  • Affinity chromatography using tags that don't interfere with protein function

  • Size exclusion chromatography for further purification

  • Quality control measures to ensure the protein maintains its native conformation

What are the current challenges in studying subunit I interactions with other V-ATPase components?

Studying interactions between V-ATPase subunits presents significant challenges due to the complex assembly process. Research indicates that subcomplexes such as VHA-B2/VHA-B2 and VHA-C1VHA-E3VHA-G3VHA-H1 might represent intermediate states of assembly . The same might be true for VHA-E/VHA-G interactions, since VHA-E is unstable in the absence of VHA-G . These findings suggest that stability issues and capturing transient interactions represent major challenges in studying subunit I interactions.

How can cryo-EM and X-ray crystallography be applied to study the structure of recombinant V-type ATPase subunit I?

Structural studies of membrane proteins like V-ATPase subunit I benefit from complementary approaches:

  • Cryo-EM allows visualization of the protein in a near-native environment and can capture different conformational states

  • X-ray crystallography provides higher resolution but requires stable crystal formation

  • Hybrid approaches combining both techniques can provide comprehensive structural insights

What statistical approaches are most appropriate for analyzing V-ATPase activity data?

Statistical analysis of enzyme activity data requires rigorous approaches. The modified toxicity probability interval (mTPI) design principles, while developed for clinical trials, can be adapted for analyzing enzyme kinetics data . This approach includes:

  • Establishing proper intervals for normal and abnormal activity

  • Creating probability models based on experimental data

  • Calculating utility measures for different experimental conditions

Table 1. Sample Activity Analysis Framework Based on mTPI Principles

Activity LevelInterval RangeInterpretation
Low activity0 to 0.24Potential inhibition or incomplete assembly
Normal activity0.25 to 0.35Properly functioning enzyme
High activity0.36 to 1.00Potential dysregulation or experimental artifact

How should researchers address contradictory findings in V-ATPase subunit I studies?

When encountering contradictory findings, researchers should systematically:

  • Compare experimental conditions including pH, temperature, and ionic strength

  • Evaluate differences in protein preparation methods

  • Consider the biological context (organism, tissue, cellular compartment)

  • Analyze statistical power and sample sizes using approaches similar to those described for clinical trial designs

  • Perform meta-analyses when multiple studies are available

What are the most reliable methods for measuring V-type ATPase activity in vitro?

Reliable methods for measuring V-ATPase activity include:

  • ATP hydrolysis assays using colorimetric detection of inorganic phosphate

  • Proton transport assays using pH-sensitive fluorescent dyes

  • ATPase activity coupled enzyme assays

These methodologies should include proper controls and calibration standards to ensure accurate quantification. The choice of method depends on whether isolated subunits or intact complexes are being studied.

How can researchers distinguish between V-type ATPase subunit I isoforms in experimental settings?

Distinguishing between isoforms requires:

  • Isoform-specific antibodies for immunodetection

  • Mass spectrometry analysis of purified proteins

  • Genetic approaches using isoform-specific knockouts or knockdowns

  • Recombinant expression of individual isoforms for comparative studies

What mechanisms regulate V-ATPase assembly and how does subunit I contribute to this process?

V-ATPase assembly is highly regulated. In yeast, V-ATPase dissociates into V₀, V₁, and VHA-C in the absence of glucose to downregulate ATP consumption . The RAVE complex plays a crucial role in reassembly and reactivation of the V-ATPase. This complex is required to incorporate VHA-C and ensure appropriate orientation of V₁ and V₀ during V-ATPase assembly . Subunit I, as part of the V₀ sector, likely provides binding sites for the RAVE complex and other assembly factors.

How do post-translational modifications affect V-type ATPase subunit I function?

Post-translational modifications may regulate:

  • Protein stability and degradation

  • Subcellular localization

  • Protein-protein interactions

  • Catalytic activity

While specific modifications of subunit I are not detailed in the search results, the V-ATPase complex appears to be under the control of canonical ER quality control mechanisms including the calnexin/calreticulin cycle .

What controls are essential when studying recombinant V-type ATPase subunit I?

Essential controls include:

  • Expression and purification controls (e.g., non-functional mutants)

  • Activity controls (e.g., specific inhibitors like bafilomycin)

  • Assembly controls (monitoring association with other subunits)

  • Quality control (assessing protein folding and stability)

Table 2. Critical Control Elements for V-ATPase Subunit Studies

Control TypePurposeImplementation
Expression verificationConfirm protein productionWestern blot, mass spectrometry
Functional controlsValidate activityATP hydrolysis assays with inhibitors
Assembly verificationConfirm proper complex formationCo-immunoprecipitation, native PAGE
Stability assessmentMonitor protein integrityThermal shift assays, limited proteolysis

How should researchers design experiments to study V-type ATPase subunit I in different cellular compartments?

Experimental design should include:

  • Compartment-specific markers for colocalization studies

  • Chimeric proteins with compartment-targeting signals

  • In vitro reconstitution with lipids mimicking specific compartments

  • Cell fractionation approaches to isolate and analyze different compartments

What are common pitfalls in recombinant expression of V-type ATPase subunit I and how can they be addressed?

Common challenges include:

  • Protein misfolding due to hydrophobic domains

    • Solution: Optimize expression temperature and use specialized host strains

  • Low expression levels

    • Solution: Use stronger promoters or codon-optimized sequences

  • Toxicity to host cells

    • Solution: Use tightly regulated inducible expression systems

  • Incomplete assembly with other subunits

    • Solution: Co-express with partner subunits that form stable subcomplexes

How can researchers troubleshoot inactive recombinant V-type ATPase preparations?

When troubleshooting inactive preparations:

  • Verify structural integrity using circular dichroism or limited proteolysis

  • Check for proper assembly of subcomplexes using native PAGE

  • Examine post-translational modifications that might be missing

  • Test different buffer conditions and reconstitution methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.