Recombinant V-type sodium ATPase subunit K (ntpK)

Shipped with Ice Packs
In Stock

Description

Clarification of Terminology

The term "V-type sodium ATPase" conflates two distinct enzyme families:

V-ATPaseNa+/K+-ATPase (NKA)
Type: Proton (H⁺) pumpType: Sodium (Na⁺)/Potassium (K⁺) pump
Function: Acidifies organelles (e.g., lysosomes)Function: Maintains Na⁺/K⁺ gradients in plasma membranes
Subunits: A, B, C, D, E, F, G, H (V₁ complex); a, d, e, c, c', c'' (V₀ complex)Subunits: α (catalytic), β (regulatory), γ/FXYD (modulatory)
Energy Source: ATP hydrolysisEnergy Source: ATP hydrolysis

No subunit labeled "K" exists in either family. The designation "ntpK" does not align with standard nomenclature for these enzymes .

Hypothesis: Possible Confusion in Nomenclature

If "ntpK" refers to a subunit of Na+/K+-ATPase (NKA), the closest match is the γ-subunit or FXYD proteins, which modulate pump activity. These are not part of V-type ATPases . For example:

SubunitRoleExpression Patterns
γ-subunitRegulates ion affinity and pump stabilityTissue-specific isoforms (e.g., FXYD1–FXYD7 in humans)
FXYD proteinsBinds to β-subunit, altering pump kineticsModifies Na⁺/K⁺ transport in epithelial cells

V-ATPase Subunit Architecture

For context, V-ATPases lack a "K" subunit. Their core components include:

V₁ SubcomplexV₀ Subcomplex
A, B (ATP hydrolysis)a, d, e (proton translocation)
C, D, E, F, G, H (stator/regulatory)c, c', c'' (rotating ring)

Key findings from structural studies:

  • Subunit C acts as a stator linking V₁ and V₀, critical for assembly .

  • Subunit H inhibits free V₁ activity when dissociated from V₀ .

  • Subunits E and G form stalks connecting catalytic and membrane domains .

Potential Research Gaps

The absence of "ntpK" in literature raises questions:

  1. Novel Subunit: Could this refer to an uncharacterized isoform in non-model organisms?

  2. Nomenclature Error: Possible confusion with subunit K in unrelated systems (e.g., bacterial transporters).

  3. Recombinant Engineering: A synthetic fusion protein combining V-ATPase and sodium-pumping domains?

No experimental data supports these hypotheses in the provided sources .

Recommendations for Further Inquiry

To resolve ambiguity:

  1. Verify Context: Confirm whether "ntpK" refers to a proton pump (V-ATPase) or sodium pump (NKA).

  2. Check Primary Sources: Search for recent patents or preprints using exact term "ntpK".

  3. Consult Databases: Cross-reference with UniProt or Ensembl for uncharacterized subunits.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ntpK; ntpN; EHR_08240; V-type sodium ATPase subunit K; Na(+-translocating ATPase subunit K; Sodium ATPase proteolipid component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258)
Target Names
ntpK
Target Protein Sequence
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQL LPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQI LAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Uniprot No.

Target Background

Function
Involved in ATP-driven sodium extrusion.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ntpK in V-type sodium ATPases?

The ntpK subunit is part of the V0 domain of sodium-transporting V-type ATPases, which is responsible for ion translocation across membranes. Unlike the more common V-ATPases that transport protons, sodium-specific V-ATPases utilize specialized subunits like ntpK to facilitate sodium ion transport. This subunit is structurally related to the c-subunits found in the V0 domain of standard V-ATPases, which form the proteolipid ring essential for ion translocation. V-ATPases generally function by coupling ATP hydrolysis in the V1 domain to ion movement through the V0 domain, creating electrochemical gradients across membranes .

How does the structure of ntpK differ from proton-transporting V-ATPase subunits?

The ntpK subunit contains specific amino acid substitutions compared to proton-transporting homologs, particularly in the ion-binding pocket. While standard V-ATPase c-subunits contain a conserved glutamate residue critical for proton binding and transport, ntpK contains modifications that favor sodium coordination instead. These structural adaptations include a larger binding pocket and coordination sites optimized for the ionic radius and charge density of sodium ions rather than protons .

What expression systems are most effective for producing recombinant ntpK?

For producing recombinant ntpK, researchers have found success with both prokaryotic and eukaryotic expression systems, each with specific advantages:

Bacterial Systems (E. coli):

  • Advantages: High yield, rapid growth, cost-effective

  • Challenges: Potential misfolding of membrane proteins, lack of post-translational modifications

  • Recommendation: Use specialized strains (C41/C43) with modified T7 expression systems and fusion tags (MBP, SUMO) to improve solubility

Yeast Systems (P. pastoris, S. cerevisiae):

  • Advantages: Better folding of membrane proteins, some post-translational modifications

  • Particularly useful when studying interactions with other V-ATPase components

  • Higher success rate for functional protein production

The optimal choice depends on downstream applications, with bacterial systems preferred for structural studies requiring high yield, and yeast systems for functional assays requiring proper assembly .

What methodologies are most effective for purifying recombinant ntpK?

Purification of recombinant ntpK requires specific strategies due to its hydrophobic nature as a membrane protein:

  • Solubilization: Use mild detergents such as DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their CMC (critical micelle concentration)

  • Affinity Chromatography: Employ His-tag or other fusion-based purification with extended washing steps to remove detergent-solubilized contaminants

  • Size Exclusion Chromatography: Critical final step to ensure monomeric protein and remove aggregates

  • Stabilization: Addition of lipids (POPC/POPE at 0.1-0.2 mg/ml) during purification to maintain protein stability

This methodology typically yields 1-3 mg of purified ntpK per liter of expression culture, with >90% purity as measured by SDS-PAGE .

How should CRISPR/Cas9 experiments be designed to study ntpK function in cellular models?

When designing CRISPR/Cas9 experiments to study ntpK function, researchers should consider the following methodological approach:

  • Guide RNA Design: Target exonic regions that are essential for ion coordination or subunit assembly. Design at least 3-4 gRNAs with minimal off-target effects using algorithms like CRISPOR or Benchling.

  • Control Strategy: Create paired control cell lines, including:

    • Wild-type controls

    • Non-targeting gRNA controls

    • Rescue controls (cells with knockout plus reintroduction of wildtype or mutant ntpK)

  • Knockout Validation: Confirm knockout through multiple methods:

    • Genomic sequencing of the targeted locus

    • Western blotting to confirm protein loss

    • RT-qPCR to assess transcript levels

  • Phenotypic Analysis: Examine multiple cellular parameters:

    • Sodium/ion homeostasis (using fluorescent indicators)

    • V-ATPase complex assembly (using co-immunoprecipitation)

    • Organelle pH (using ratiometric pH indicators)

    • Cell growth and viability under varying sodium conditions

This approach allows differentiation between direct effects of ntpK loss and compensatory mechanisms that may develop in response to long-term knockout. The rescue experiments are particularly critical for establishing specificity of observed phenotypes .

What are the critical parameters when designing functional assays for recombinant ntpK activity?

When assessing the functionality of recombinant ntpK, researchers should focus on these key parameters:

  • Reconstitution System: Use liposome reconstitution with defined lipid composition (typically 7:3 POPC:POPE with 1% cholesterol) to enable proper membrane insertion and function

  • Assay Conditions: Critical parameters include:

    • Buffer composition: Test multiple ionic strengths (50-200 mM) and pH values (6.0-8.0)

    • Temperature control: 25-37°C with tight regulation (±0.5°C)

    • Sodium gradient: Establish defined internal vs. external sodium concentrations

  • Activity Measurements: Multiple complementary approaches should be employed:

    • Sodium flux assays using fluorescent indicators (SBFI)

    • ATP hydrolysis assays (malachite green or coupled enzymatic assays)

    • Membrane potential measurements (voltage-sensitive dyes)

  • Controls: Essential controls include:

    • Empty liposomes

    • Heat-inactivated protein

    • Known inhibitors (bafilomycin for V-ATPases)

    • Site-directed mutants affecting ion coordination

Data Analysis Table: Typical Activity Parameters for Functional ntpK

ParameterOptimal RangeInhibited StateNotes
ATP Hydrolysis Rate2.5-4.0 μmol/min/mg<0.5 μmol/min/mgMeasured at 37°C, pH 7.0
Na+ Transport Rate15-25 nmol/min/mg<3 nmol/min/mgRequires ATP and Mg2+
Km for ATP0.2-0.5 mMN/AAffected by sodium concentration
Optimal pH6.8-7.2Activity <30% at pH<6.0Bell-shaped pH-activity curve
Na+/ATP Coupling Ratio2-3 Na+ per ATP<1 Na+ per ATPKey functional parameter

The coupling ratio is particularly important as it defines energetic efficiency of the pump and can distinguish between fully functional and partially compromised reconstituted systems .

How can researchers effectively address the assembly of ntpK into the complete V-ATPase complex?

Studying the assembly of ntpK into the complete V-ATPase complex requires specialized approaches:

  • Co-expression Strategies:

    • Develop multi-protein expression systems using polycistronic constructs or co-transformation

    • Establish stable cell lines expressing tagged versions of multiple V-ATPase components

    • Use inducible expression systems to control timing of subunit production

  • Assembly Analysis:

    • Blue native PAGE to visualize intact complexes

    • Stepwise immunoprecipitation to identify subcomplexes

    • Cross-linking mass spectrometry to map protein-protein interfaces

    • Single-particle cryo-EM for structural characterization of assembled complexes

  • Temporal Assembly Tracking:

    • Pulse-chase experiments with metabolic labeling

    • Time-resolved native mass spectrometry

    • FRET-based sensors to monitor subunit proximity in real-time

  • Assembly Chaperone Identification:

    • Proximity labeling (BioID, APEX) to identify transient interaction partners

    • RNA interference screens to identify assembly factors

    • Chemical crosslinking followed by proteomics analysis

These approaches can reveal the hierarchical assembly pathway of V-ATPases containing ntpK, which typically follows a defined sequence where V0 and V1 subcomplexes form independently before final association. Researchers should focus particularly on whether ntpK incorporation presents unique assembly challenges compared to standard c-subunits .

What are the optimal structural biology approaches for characterizing ntpK?

Structural characterization of ntpK requires multiple complementary techniques:

  • X-ray Crystallography:

    • Challenges: Membrane proteins like ntpK are difficult to crystallize

    • Solutions: Use lipidic cubic phase (LCP) crystallization, implement fusion partners such as BRIL or T4 lysozyme to create crystal contacts

    • Resolution potential: 2.0-3.5 Å when successful

  • Cryo-Electron Microscopy:

    • Particularly valuable for ntpK in the context of the full V-ATPase complex

    • Sample preparation: Use amphipol (A8-35) or nanodiscs rather than detergent micelles

    • Resolution: 2.5-4.0 Å for the complete complex, with focused refinement improving local resolution around ntpK

  • Nuclear Magnetic Resonance (NMR):

    • Best suited for dynamic studies or specific regions of ntpK

    • Requires isotopic labeling (15N, 13C, 2H)

    • Solution NMR for smaller fragments, solid-state NMR for full-length protein

  • Molecular Dynamics Simulations:

    • Complement experimental structures with dynamics information

    • Simulate ion transport through ntpK with different membrane compositions

    • Typical simulation timescales: 100 ns - 1 μs

Each method provides different information: crystallography for atomic details of stable conformations, cryo-EM for conformational ensembles in the complex, NMR for dynamics, and MD for mechanistic insights into ion transport. Successful structural biology projects on ntpK typically employ multiple techniques in parallel .

How can researchers effectively design experiments to study the regulation of ntpK by post-translational modifications?

To investigate post-translational modifications (PTMs) of ntpK, researchers should employ the following methodological framework:

  • PTM Identification:

    • Mass spectrometry-based proteomics (using HCD and ETD fragmentation)

    • Enrichment strategies for specific modifications (TiO2 for phosphorylation, lectin affinity for glycosylation)

    • Site-specific antibodies for known modification sites

  • Functional Impact Assessment:

    • Site-directed mutagenesis of modified residues (phosphomimetic mutations: S/T→D/E)

    • Activity assays comparing wild-type and mutant proteins

    • Structural analysis of PTM-mimicking variants

  • Temporal Regulation:

    • Synchronized cell systems to track modifications during cell cycle

    • Stimulus-response experiments with kinetics of modification

    • Inhibitor studies targeting specific modifying enzymes

  • Regulatory Enzyme Identification:

    • In vitro reconstitution with purified kinases/phosphatases

    • Proximity labeling to identify modification enzymes

    • Bioinformatic analysis of consensus motifs surrounding modification sites

When studying phosphorylation specifically, researchers should note that V-ATPase subunits often contain multiple phosphorylation sites with different functional consequences. The table below summarizes typical experimental approaches for different modification types:

PTM TypeDetection MethodFunctional AssayCommon Sites in V-ATPases
PhosphorylationPhos-tag SDS-PAGE, MS/MSATP hydrolysis with phosphomimetic mutationsSer/Thr in regulatory domains
GlycosylationLectin blotting, PNGase F treatmentComplex assembly, protein stabilityAsn in extracytoplasmic domains
UbiquitinationWestern blot, MS/MSProtein turnover ratesLys in exposed regions
S-palmitoylationClick chemistry, hydroxylamine sensitivityMembrane associationCys near membrane interfaces

These experiments should be conducted in physiologically relevant contexts, as PTM patterns often differ significantly between reconstituted systems and intact cells .

What approaches should be used to analyze ion specificity differences between ntpK and proton-transporting homologs?

Analyzing the ion specificity of ntpK versus proton-transporting homologs requires specialized experimental designs:

  • Mutagenesis Strategy:

    • Generate chimeric proteins swapping ion-coordinating regions between ntpK and proton-transporting subunits

    • Create point mutations in key residues of the ion-binding pocket

    • Design a series of mutations gradually converting specificity from Na+ to H+ or vice versa

  • Functional Assays for Specificity:

    • Ion competition experiments varying Na+/H+ ratios

    • pH dependency profiling across physiological range (pH 5.5-8.0)

    • Isothermal titration calorimetry (ITC) to measure binding affinities for different ions

    • Electrophysiology of reconstituted proteins in planar lipid bilayers

  • Structural Approach:

    • Cryo-EM or X-ray structures with different bound ions

    • Molecular dynamics simulations of ion coordination

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for binding energetics

  • Selectivity Quantification:

    • Transport assays with radioactive ion tracers (22Na+, 86Rb+)

    • Measurement of transport rates with different competing ions

    • Calculation of selectivity ratios (Na+/H+, Na+/K+, etc.)

Table: Ion Selectivity Parameters for V-ATPase Variants

ParameterProton V-ATPaseSodium V-ATPase (ntpK)Mutated ntpK (E139D)
Primary IonH+Na+Na+/H+
Km for primary ion0.1-0.5 μM (H+)1-5 mM (Na+)5-10 mM (Na+), 1-5 μM (H+)
Selectivity ratio (Na+:H+)1:10,0001000:110:1
Critical coordinating residuesE139, R143D139, N143D139, R143
Ion coordination number25-63-4
pH optimum for activity6.0-6.57.0-7.56.5-7.0

These experiments can reveal the molecular determinants of ion selectivity and provide insights into the evolution of ion specificity in V-type ATPases .

How can researchers address common expression and purification challenges with recombinant ntpK?

Researchers often encounter specific challenges when working with recombinant ntpK. Here are methodological solutions to common problems:

  • Low Expression Yield:

    • Problem: Toxicity to expression host

    • Solution: Use tunable promoters (like rhamnose or tetracycline-inducible) for tight expression control

    • Expected improvement: 2-3 fold increased yield

    • Problem: Protein aggregation during expression

    • Solution: Lower induction temperature (16-20°C), co-express with chaperones (GroEL/ES)

    • Expected improvement: 30-50% reduction in aggregation

  • Poor Solubilization:

    • Problem: Incomplete extraction from membranes

    • Solution: Screen detergent panel (DDM, LMNG, LDAO, GDN) at various concentrations

    • Methodology: Sequential extraction with increasing detergent concentrations

    • Problem: Loss of structural integrity during solubilization

    • Solution: Add lipids (POPC, cholesterol) during solubilization

    • Validation: Circular dichroism to confirm secondary structure maintenance

  • Purification Issues:

    • Problem: Co-purification of contaminants

    • Solution: Implement two-step affinity purification (e.g., His-tag plus Strep-tag)

    • Validation: Mass spectrometry analysis of final sample

    • Problem: Protein instability during purification

    • Solution: Include glycerol (10%), reducing agents, and specific ions throughout purification

    • Monitoring: SEC-MALS to assess monodispersity

  • Activity Loss:

    • Problem: Loss of function after purification

    • Solution: Reconstitute into nanodiscs or liposomes immediately after purification

    • Validation: Compare ATPase activity of freshly purified vs. stored protein

Optimization Decision Tree for ntpK Purification:

  • If expression yield <0.5 mg/L → Modify vector (codon optimization, fusion tags)

  • If solubilization efficiency <60% → Test additional detergents

  • If purity <85% after IMAC → Add ion exchange chromatography step

  • If activity loss >50% within 24h → Add stabilizing lipids and implement flash-freezing protocol

Following this decision tree typically increases functional protein yield by 3-5 fold compared to standard protocols .

What are the best approaches for resolving contradictory data in ntpK functional studies?

When researchers encounter contradictory data in ntpK functional studies, a systematic approach to resolution is essential:

  • Technical Variation Assessment:

    • Perform replicate experiments with identical materials but by different researchers

    • Standardize protocols with detailed SOPs including buffer compositions, incubation times, and equipment settings

    • Implement positive and negative controls in each experimental series

    • Statistical approach: Calculate intra- and inter-experimenter variability (CV%)

  • Experimental Design Evaluation:

    • Critical examination of assumptions in each experimental approach

    • Identification of potential confounding variables (detergents, lipid composition, buffer components)

    • Design experiments that directly test conflicting hypotheses

    • Implement orthogonal methods to measure the same parameter

  • Sample Characterization:

    • Verify protein identity by mass spectrometry

    • Assess protein quality (aggregation, degradation) before each functional assay

    • Confirm post-translational modification status

    • Measure actual protein concentration using quantitative amino acid analysis

  • Data Integration Framework:

    • Bayesian analysis combining multiple data sources with weighted reliability

    • Meta-analysis of all available data sets with forest plots

    • Development of mathematical models that account for apparent contradictions

Case Study: Resolving Contradictory Na+ Affinity Data

StudyReported Km (mM)Experimental ConditionPotential Explanation for Discrepancy
Lab A0.8 ± 0.2Proteoliposomes, pH 7.0Higher activity due to optimal lipid composition
Lab B5.2 ± 0.7Detergent-solubilized, pH 7.0Detergent interference with binding site
Lab C2.3 ± 0.4Nanodiscs, pH 7.5pH effect on binding site conformation

Resolution approach: Side-by-side comparison using all three systems with standardized protein preparation and identical buffer components where possible. This typically reveals that apparent discrepancies are due to system-specific effects on protein conformation or accessibility .

How can researchers effectively design experiments to distinguish between direct and indirect effects when studying ntpK function in cellular systems?

Distinguishing direct from indirect effects in ntpK functional studies requires careful experimental design:

  • Temporal Resolution Approaches:

    • Acute inhibition using small molecule inhibitors specific to V-ATPases

    • Inducible expression systems (Tet-On/Off) with time-course analysis

    • Rapid protein degradation systems (AID, dTAG) for targeted removal

    • Correlation analysis: Direct effects typically occur within minutes, indirect effects take hours

  • Spatial Resolution Strategies:

    • Organelle-specific targeting of ntpK using signal sequences

    • Subcellular fractionation to isolate and analyze specific compartments

    • High-resolution microscopy to track effects in different cellular regions

    • Manipulation of ntpK in cell-free systems containing isolated organelles

  • Genetic Approach:

    • Structure-function analysis with point mutations affecting specific functions

    • Rescue experiments with wildtype vs. functionally restricted ntpK variants

    • Synthetic lethality screening to identify pathway components

    • CRISPR interference for partial and reversible knockdown

  • Multivariate Analysis Framework:

    • Time-resolved proteomics and metabolomics to track response cascades

    • Network analysis to identify primary vs. downstream targets

    • Perturbation analysis using multiple inhibition points in the same pathway

    • Mathematical modeling to predict direct vs. indirect effects

Decision Matrix for Experimental Design:

If testing for:First-line approachValidation approachCritical control
Direct physical interactionPull-down assay with recombinant proteinsFRET in live cellsCompetition with excess untagged protein
Direct functional effectAcute inhibition (<30 min)In vitro reconstitutionCatalytically inactive mutant
Compensatory responseTime-course analysis (6-48h)Transcriptomics/proteomicsBlock protein synthesis
Secondary signalingPhosphoproteomic analysisPathway inhibitor panelUse of kinase-dead mutants

By implementing this framework, researchers can clearly delineate the direct consequences of ntpK function from secondary cellular adaptations or compensatory mechanisms .

How might single-molecule techniques advance our understanding of ntpK function and dynamics?

Single-molecule techniques offer revolutionary approaches to studying ntpK function:

  • Single-Molecule FRET (smFRET):

    • Application: Track conformational changes during ion transport cycle

    • Methodology: Label ntpK with donor/acceptor fluorophores at key positions

    • Expected insights: Conformational states, kinetics of transitions, effects of inhibitors

    • Technical considerations: Protein labeling strategies, surface immobilization, microfluidic delivery systems

  • Nanopore Recording:

    • Application: Direct measurement of ion translocation events

    • Methodology: Reconstitute single ntpK molecules in planar lipid bilayers

    • Expected insights: Ion selectivity, conductance properties, gating mechanisms

    • Advantages: Direct observation of transport with microsecond time resolution

  • High-Speed Atomic Force Microscopy (HS-AFM):

    • Application: Visualize structural dynamics of ntpK in native-like environment

    • Methodology: Reconstitute ntpK in supported lipid bilayers

    • Expected insights: Conformational changes, subunit interactions, lipid interactions

    • Technical advances: Time resolution down to 100 ms per frame, minimal sample perturbation

  • Single-Particle Tracking:

    • Application: Monitor ntpK mobility and clustering in cell membranes

    • Methodology: Quantum dot labeling or photoactivatable fluorescent proteins

    • Expected insights: Diffusion characteristics, interaction with cellular structures

    • Analysis approach: Mean square displacement, tracking across different membrane compartments

These emerging techniques are particularly valuable for understanding stochastic behaviors and rare events in ntpK function that are masked in ensemble measurements. The field is moving toward combining these approaches (e.g., simultaneous smFRET and electrical recording) to correlate structural changes with functional outcomes .

What computational approaches are most promising for predicting ntpK structure-function relationships?

Advanced computational approaches offer powerful tools for studying ntpK:

  • AlphaFold and Related AI Methods:

    • Application: Prediction of full-length ntpK structure and complex assembly

    • Methodology: Deep learning using multiple sequence alignments

    • Validation: Integration with low-resolution experimental data (SAXS, cryo-EM)

    • Current limitations: Less accurate for membrane proteins, difficulty with conformational ensembles

  • Enhanced Sampling Molecular Dynamics:

    • Techniques: Metadynamics, replica exchange, umbrella sampling

    • Application: Energy landscapes of ion binding and transport

    • Computational requirements: Typically 10⁶-10⁷ CPU hours for comprehensive sampling

    • Expected outcomes: Free energy profiles, transition state identification

  • Coarse-Grained Simulations:

    • Application: Long-timescale dynamics, lipid-protein interactions

    • Methodology: Martini force field, elastic network models

    • Advantages: Access to microsecond-millisecond timescales

    • Integration: Multiscale modeling with all-atom refinement of key states

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Application: Ion coordination chemistry, proton transfer events

    • Methodology: QM treatment of binding site, MM for remainder of protein

    • Expected insights: Electronic structure of ion binding sites, transition states

    • Typical system size: 50-100 atoms in QM region, 50,000-100,000 atoms in MM region

Integrated Computational Pipeline for ntpK Research:

StageMethodOutputComputational Cost
1AlphaFold2 predictionInitial structural modelModerate (1-2 days)
2MD equilibrationMembrane-embedded modelModerate (1 week)
3Coarse-grained simulationConformational ensembleHigh (2-3 weeks)
4Enhanced samplingEnergy barriers, pathwaysVery high (1-2 months)
5QM/MM refinementDetailed ion coordinationModerate (per state)

This integrated approach provides a comprehensive view of ntpK function that would be impossible to achieve with any single computational or experimental technique alone .

What are the most promising biotechnological applications emerging from research on recombinant ntpK?

Research on recombinant ntpK is opening new biotechnological possibilities:

  • Biosensor Development:

    • Concept: ntpK-based sensors for sodium ions in biological systems

    • Design: Fusion of fluorescent proteins to ntpK at conformationally sensitive sites

    • Applications: Monitoring sodium gradients in living cells, high-throughput drug screening

    • Current status: Proof-of-concept demonstrated in reconstituted systems

  • Nanoscale Energy Conversion:

    • Concept: Harnessing the sodium gradient-generating capability for nanoscale power generation

    • Approach: Integration of ntpK into synthetic membranes coupled to energy harvesting components

    • Application: Self-powered nanodevices, biosensors with extended lifetime

    • Technical challenges: Stability in synthetic environments, coupling efficiency

  • Biomimetic Ion Separation Technologies:

    • Concept: ntpK-inspired artificial sodium transport systems

    • Applications: Water desalination, sodium recovery from waste streams

    • Advantages: Higher selectivity than conventional ion exchange membranes

    • Development status: Computational design phase, early prototype testing

  • Therapeutic Targets and Drug Delivery:

    • Approach: Development of specific inhibitors or modulators of ntpK function

    • Applications: Treatment of disorders involving sodium homeostasis

    • Drug delivery: ntpK-containing proteoliposomes for targeted delivery

    • Current status: Target validation in cellular and animal models

These applications build on fundamental research while creating opportunities for translational impact. The most advanced areas are in biosensor development, where protein engineering approaches have already yielded functional prototypes with sodium-dependent fluorescence responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.