Recombinant Vaccinia virus 36 kDa major membrane protein (F5L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
F5L; 36 kDa major membrane protein F5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-321
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
F5L
Target Protein Sequence
IEYDVDDNVHICTHTDVSHINHTSWYYNDKVIALATEDKTSGYISSFIKRVNISLTCLNI SSLRYEDSGTYKGVSHLKDGVIVTTTMNISVKANIIDLTGRVRYLTRNYCEVKIRCEITS FALNGSTTPPHMILGTVDKWKYLPFPTDDYRYVGELKRYISGNPYPTESLALEISSTFNR FTIVKNLNDDEFSCYLFSQNYSFHKMLNARHICESEWKALNNNDNASSMPASHNNLANDL SSMMSQLQNDNDDNNDYSAPMNVDNLIMIVLITMLSIILVIIVVIAAISMYKKSKYRHID N
Uniprot No.

Target Background

Protein Families
Poxviridae F5 protein family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the F5L protein and what is its primary function in Vaccinia virus?

The F5L gene in Vaccinia virus encodes a 36 kDa major membrane protein that primarily influences plaque morphology without significantly affecting virus replication. F5L belongs to a group of Vaccinia virus proteins that influence plaque formation more strongly than virus replication. Research has demonstrated that F5L is required for normal plaque morphology in multiple cell lines and promotes the formation of central plaque clearing. Interestingly, despite its impact on plaque size, deletion of F5L does not significantly reduce virus replication or spread in vitro or in vivo .

How does F5L differ across Vaccinia virus strains, particularly in MVA?

The F5L gene is notably truncated in Modified Vaccinia virus Ankara (MVA), a highly attenuated strain used as a vaccine vector . This truncation contributes to MVA's distinct plaque morphology characteristics. In contrast, virulent strains like Western Reserve (WR) maintain an intact F5L gene that contributes to normal plaque formation. The truncation of F5L in MVA is one of several genetic modifications that occurred during the extensive serial passage that led to MVA's attenuation . Understanding these differences provides insights into strain-specific behaviors and helps researchers interpret results when comparing different Vaccinia virus strains.

What experimental systems best demonstrate F5L's effects?

F5L's effects are most clearly demonstrated in plaque morphology assays using multiple cell lines, as its influence varies in a cell type-dependent manner . When studying F5L, researchers should include both cell lines that show prominent F5L-dependent effects and those that do not, to establish the specificity of observations. In vivo models such as mouse infection studies can also be valuable, though F5L deletion does not significantly affect virulence in these models . When designing experiments, it's critical to include appropriate controls, such as rescue viruses where the F5L gene has been reintroduced, to confirm that observed phenotypes are specifically due to F5L rather than secondary mutations.

What approaches are most effective for generating F5L recombinant Vaccinia viruses?

Generation of recombinant Vaccinia viruses with modified F5L requires careful experimental design. A typical workflow includes:

  • Construction of a transfer plasmid containing the modified F5L gene (or deletion construct) flanked by homologous viral sequences

  • Infection of permissive cells with parental virus, followed by transfection with the transfer plasmid

  • Homologous recombination between viral DNA and the plasmid

  • Selection and purification of recombinant viruses, typically through multiple rounds of plaque purification

  • Verification of recombinants by PCR, sequencing, and protein expression analysis

For MVA-based recombinants, special considerations apply due to its growth restrictions in mammalian cells. Researchers often use marker rescue techniques to reintroduce functional F5L into MVA for comparative studies . The protocol described by Li (2021) for generating recombinant Vaccinia viruses provides a detailed methodology that can be adapted for F5L studies .

How should researchers quantify and analyze F5L's effects on plaque morphology?

Quantifying F5L's effects on plaque morphology requires rigorous methodological approaches:

  • Infect monolayers of appropriate cell lines with wild-type and F5L-modified viruses at low multiplicity of infection

  • Allow plaques to develop (typically 48-72 hours post-infection)

  • Fix and stain cell monolayers (e.g., with crystal violet)

  • Image plaques using consistent magnification and lighting conditions

  • Measure plaque parameters using image analysis software:

    • Diameter/area (primary measurement)

    • Presence/absence of central clearing

    • Formation of comets (if studying in combination with other genes)

  • Analyze data using appropriate statistical methods (t-tests, ANOVA)

It's critical to test multiple cell lines as F5L's effects vary between cell types . Analyzing at least 30-50 plaques per condition across a minimum of three independent experiments will provide robust statistical power.

What controls are essential when studying F5L function?

Proper controls are critical for F5L studies and should include:

  • Parental virus with intact F5L (positive control)

  • F5L deletion mutant (complete removal of the gene)

  • F5L rescue virus (deletion mutant with reintroduced F5L) to control for secondary mutations

  • Cell line controls (both F5L-responsive and non-responsive cell types)

  • Time-matched samples for replication studies

When studying F5L in the context of MVA, researchers should be aware that multiple genes are disrupted in this strain, which can confound interpretation of results . Therefore, including appropriate recombinant controls with specific gene restorations is essential for attributing observed phenotypes specifically to F5L.

How does F5L interact with other Vaccinia virus proteins involved in plaque morphology?

F5L is one of several Vaccinia virus proteins that influence plaque morphology. Research has identified multiple genes affecting this phenotype, including F11L, F12L, F13L, A33R, A34R, A36R, A56R, and B5R . The interaction network between these proteins represents an important area for advanced research.

GeneEffect on Plaque MorphologyStatus in MVAEffect on Virus Replication
F5LCentral plaque clearingTruncatedMinimal to none
F11LPlaque sizeFragmentedMinimal to none
A33RComet formationIntact in MVA-HANPVariable
A34RComet formationIntact in MVA-HANPVariable
A36RPlaque sizeContains deletionsVariable
B5RComet formationIntact in MVA-HANPVariable

To investigate interactions between F5L and these proteins, researchers should employ:

  • Co-immunoprecipitation and proximity ligation assays

  • Creation of double knockout viruses to assess epistatic relationships

  • Fluorescent protein tagging to visualize co-localization

  • Proteomics approaches to identify interaction partners

Studies have shown that recombinant viruses containing defective versions of multiple plaque morphology genes display complex phenotypes, suggesting functional interactions between these factors .

What molecular mechanisms underlie F5L's effect on plaque morphology?

The precise molecular mechanisms by which F5L influences plaque morphology remain incompletely understood. Current research suggests several possibilities that warrant investigation:

Advanced methodological approaches for investigating these mechanisms include:

  • Structure-function analysis through site-directed mutagenesis

  • Subcellular localization studies using immunofluorescence microscopy

  • Live-cell imaging to track virus spread in real-time

  • Transcriptomic and proteomic analysis of host responses to F5L expression

The cell-type dependency of F5L's effects suggests interactions with host factors that vary between cell types , presenting an additional layer of complexity for investigation.

How does the F5L protein contribute to the viral lifecycle beyond plaque morphology?

While F5L's primary characterized function relates to plaque morphology, its potential roles in other aspects of the viral lifecycle merit investigation. Advanced research questions include:

These questions can be addressed through:

  • Comparative immunology studies in F5L-positive versus F5L-negative infections

  • Infection studies in specialized cell types (e.g., primary cells from different tissues)

  • Electron microscopy to examine viral particle structure

  • Systems biology approaches to identify subtle phenotypes not apparent in standard assays

Research has already established that despite reducing plaque size, F5L deletion does not significantly affect virus burden in mouse models , suggesting its role may be more nuanced than initially apparent.

How should researchers interpret contradictory data regarding F5L's effects in different experimental systems?

Researchers frequently encounter seemingly contradictory results when studying F5L across different experimental systems. A systematic approach to resolving these contradictions includes:

  • Cell-type considerations: F5L's effects are cell-type dependent . Document and analyze exactly which cell lines show which phenotypes.

  • Virus strain differences: Compare results between different vaccinia strains (WR, MVA, etc.) with attention to their genetic backgrounds.

  • Measurement parameters: Distinguish between plaque morphology (size, appearance) and virus replication (titers, spread).

  • Temporal factors: Consider whether observations are from early or late timepoints post-infection.

What bioinformatic approaches can be used to predict F5L function based on sequence analysis?

Bioinformatic analysis of F5L can provide valuable insights into its function:

  • Sequence homology analysis: Compare F5L across poxvirus species to identify conserved regions

  • Structural prediction: Use tools like AlphaFold to predict F5L protein structure

  • Transmembrane domain prediction: Identify potential membrane-spanning regions

  • Post-translational modification site prediction: Identify potential phosphorylation or glycosylation sites

  • Protein-protein interaction prediction: Identify potential binding partners

When conducting these analyses, researchers should be aware that F5L may have unique features not present in well-characterized proteins, limiting the predictive power of some bioinformatic approaches. Combining computational predictions with experimental validation is essential.

How can researchers differentiate F5L-specific effects from those caused by other viral factors?

Differentiating F5L-specific effects from those mediated by other viral factors requires:

  • Clean genetic systems: Use precisely engineered recombinant viruses with minimal off-target effects

  • Rescue experiments: Reintroduce F5L to deletion mutants to confirm phenotype reversion

  • Domain-specific mutations: Target specific F5L domains rather than deleting the entire gene

  • Complementation studies: Express F5L in trans to determine if it complements deletion phenotypes

  • Comparative studies: Compare F5L-deficient viruses with other single-gene mutants

Researchers should be particularly cautious when studying F5L in the context of MVA, as this strain contains multiple disrupted genes that could interact functionally with F5L . This can confound the interpretation of marker rescue experiments designed to map mutations responsible for attenuation.

How might F5L research inform the development of improved Vaccinia virus vaccine vectors?

Understanding F5L function has significant implications for vaccine vector development:

  • Vector spread control: Modifying F5L could allow fine-tuning of vector spread in tissues

  • Plaque phenotype engineering: Creating vectors with specific plaque characteristics for optimized immunogenicity

  • Attenuation mechanisms: Insight into F5L's role in MVA attenuation could inform rational design of new attenuated vectors

  • Cell-type targeting: Leveraging F5L's cell-type dependent effects for targeted vector design

Research has already demonstrated that F5L affects plaque morphology without compromising replication or immunogenicity , suggesting it could be an ideal target for vector optimization. Creating F5L variants with enhanced or altered function could potentially improve vaccine efficacy while maintaining safety profiles.

What emerging technologies could advance our understanding of F5L function?

Several cutting-edge technologies hold promise for advancing F5L research:

  • CRISPR/Cas9 genome editing: Creating precise modifications to F5L with minimal off-target effects

  • Cryo-electron microscopy: Determining F5L structure and membrane interactions at high resolution

  • Proximity labeling proteomics (BioID, APEX): Identifying F5L interaction partners in living cells

  • Super-resolution microscopy: Visualizing F5L localization and dynamics at nanoscale resolution

  • Single-cell analysis: Understanding cell-to-cell heterogeneity in F5L expression and function

  • Organoid cultures: Studying F5L function in more physiologically relevant 3D tissue models

These technologies could overcome limitations of traditional approaches and provide new insights into F5L's molecular mechanisms, particularly regarding its membrane organization and protein interactions.

How does F5L compare to analogous proteins in other poxviruses, and what are the evolutionary implications?

Comparative analysis of F5L across the poxvirus family represents an important research frontier:

  • Sequence conservation: Identify highly conserved regions likely critical for function

  • Species-specific adaptations: Determine if F5L varies between poxviruses with different host ranges

  • Evolutionary pressure: Analyze selection signatures to identify regions under positive selection

  • Functional complementation: Test if F5L from one poxvirus species can functionally replace another

Such comparative approaches could reveal whether F5L's role in plaque morphology represents a conserved function across poxviruses or a specialized adaptation in certain lineages. This evolutionary perspective could provide insights into the fundamental biology of poxvirus spread and host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.