Recombinant Vaccinia virus Cell surface-binding protein (MVA105L, ACAM3000_MVA_105)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vaccinia Virus Cell Surface-Binding Protein (MVA105L, ACAM3000_MVA_105)

Recombinant Vaccinia virus Cell surface-binding protein (MVA105L, ACAM3000_MVA_105) is a full-length protein derived from the Modified Vaccinia Ankara (MVA) strain of Vaccinia virus. It is a homolog of carbonic anhydrase and plays a critical role in viral adhesion and entry into host cells. The recombinant version is engineered with an N-terminal His tag, expressed in E. coli, and purified to >90% homogeneity .

Expression and Purification

  • Host: E. coli (for most commercial products) .

  • Purification: Affinity chromatography (His tag) followed by SDS-PAGE validation .

  • Reconstitution: Recommended in sterile water at 0.1–1.0 mg/mL, with optional glycerol addition (5–50%) for stability .

Role in Vaccine Platforms

MVA105L is integral to MVA-based vaccines, which are replication-deficient and safer than traditional Vaccinia strains . Key applications include:

  1. Immune Response Studies:

    • T-cell Epitope Mapping: A peptide pool (PepMix™) spanning MVA105L’s sequence is used to assess antigen-specific T-cell responses .

    • Monoclonal Antibody Development: The 33C7 antibody targets MVA105L for flow cytometry-based titration of MVA-infected cells, offering higher precision than traditional PFU assays .

  2. Genetic Stability in Recombinant MVA:

    • Transgene Expression: Sustained knock-down of MVA105L expression in engineered cell lines (e.g., CR pIX PRO) improves viral replication and reduces mutations in foreign genes .

    • Homonucleotide Runs: Silent codon modifications in MVA105L’s homonucleotide regions (e.g., G/C runs) prevent frameshift mutations, enhancing genetic stability during serial passaging .

Genetic Instability Mechanisms

FactorImpactSource
Homonucleotide RunsProne to insertions/deletions (indels) during replication
Transgene ExpressionUnrestricted expression reduces MVA replication efficiency

Optimized Titration Methods

MethodAdvantagesSource
Flow Cytometry (33C7)Higher sensitivity, reduced processing time vs. PFU assay

Diagnostic Tools

  • ELISA Kits: Detect MVA105L using recombinant protein-coated plates .

  • Antibodies: Monoclonal antibodies (e.g., 33C7) for immunostaining and titration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MVA105L; ACAM3000_MVA_105; D8L; Cell surface-binding protein; Carbonic anhydrase homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Vaccinia virus (strain Ankara) (VACV)
Target Names
MVA105L
Target Protein Sequence
MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSSLRIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRSTNTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADA VWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTSPARENYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVFILTAILFFMSQRYSR EKQN
Uniprot No.

Target Background

Function

Binds to cell surface chondroitin sulfate, mediating virion attachment to the target cell.

Protein Families
Alpha-carbonic anhydrase family
Subcellular Location
Virion membrane.

Q&A

What are the optimal storage conditions for recombinant MVA105L protein?

For long-term stability of recombinant MVA105L protein, the following storage protocol is recommended:

  • Store lyophilized powder at -20°C to -80°C upon receipt

  • For reconstituted protein:

    • Add 5-50% glycerol (typically 50% final concentration) as a cryoprotectant

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store aliquots at -20°C to -80°C for long-term storage

    • Working aliquots can be stored at 4°C for up to one week

The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Before opening, briefly centrifuge the vial to bring contents to the bottom. The recommended storage buffer is Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How can I express recombinant MVA105L protein in a laboratory setting?

Recombinant MVA105L protein can be efficiently expressed in E. coli expression systems. The general protocol involves:

  • Clone the full-length gene sequence (encoding amino acids 1-304) into an appropriate expression vector

  • Add an N-terminal His-tag for purification purposes

  • Transform the construct into E. coli

  • Induce protein expression using standard protocols

  • Purify using affinity chromatography, taking advantage of the His-tag

  • Confirm protein identity and purity using SDS-PAGE (should show >90% purity)

For viral expression, the gene can be incorporated into a vaccinia virus vector using homologous recombination techniques. This involves:

  • Constructing a plasmid transfer vector containing MVA105L flanked by vaccinia virus genome sequences

  • Transfecting this plasmid into cells previously infected with vaccinia virus

  • Allowing homologous recombination to occur

  • Isolating and purifying the recombinant virus through several rounds of plaque purification

How does MVA105L compare functionally to other vaccinia virus surface proteins?

MVA105L (also known as D8L) functions as a cell surface-binding protein, but its relationship with other surface proteins is complex. Studies on the L1 protein, another vaccinia virus envelope protein, demonstrate that L1 binds to cell surfaces independently of glycosaminoglycans (GAGs) and can block virus entry by competing with virions for receptor binding .

Unlike L1, which appears to function as a receptor binding protein (RBP), the A28 protein (another vaccinia envelope protein) does not show direct cell surface binding and likely functions after attachment during the entry process . This differentiation in function highlights the specialized roles of vaccinia surface proteins.

When designing experiments to investigate MVA105L function, researchers should consider:

  • Competitive binding assays with other surface proteins

  • Cell entry inhibition studies

  • Receptor identification experiments

  • Structure-function analysis through mutation studies

What strategies can be employed to generate recombinant vaccinia viruses expressing modified versions of MVA105L?

Creating recombinant vaccinia viruses with modified MVA105L requires several strategic considerations:

  • Vector Selection Method:

    • XGPRT (xanthine-guanine phosphoribosyltransferase) selection system

    • TK (thymidine kinase) selection system

    • Drug-free plaque selection based on phenotypic repair

  • Screening Method Options:

    • GFP (green fluorescent protein) reporter system

    • β-galactosidase screening

    • β-glucuronidase (GUS) screening

  • Procedural Protocol:

    StepMethodCell Type
    Virus InfectionInfect cells with parent virusBS-C-1 (standard vaccinia) or CEF/BHK-21 (for MVA)
    TransfectionTransfect with plasmid containing modified MVA105LSame as above
    SelectionApply appropriate selection pressureTK-deficient cells (for TK selection)
    Plaque PurificationMultiple rounds of plaque isolationBased on selection marker
    AmplificationSuccessive infections of larger cell numbersWith continued selection pressure

For site-directed modifications to MVA105L, PCR-based mutagenesis followed by recombination is most efficient. When amplifying recombinant viruses from plaques, the virus can be expanded through infection of successively larger numbers of cells, with titer determination following standard protocols .

How can trimerization of MVA105L be achieved for enhanced immunogenicity in vaccine applications?

Trimerization of MVA105L can significantly enhance its immunogenicity for vaccine applications. Based on research with other viral proteins, the following approach has proven effective:

  • Design a construct that fuses a trimerization domain to MVA105L. For example, a 27-residue (GYIPEAPRDGQAYVRKDGEWVLLSTFL) trimerization domain derived from the C-terminal bacteriophage T4 fibritin can be used .

  • Create a recombinant vaccinia virus expressing this trimeric construct using homologous recombination techniques .

The trimerization approach offers several advantages:

  • Mimics the native structure of viral surface proteins

  • Enhances immunogenicity compared to monomeric proteins

  • Provides better presentation of conformational epitopes

  • Can stimulate both systemic and mucosal immune responses when delivered through appropriate routes

This strategy has been successfully employed with the receptor-binding domain (RBD) of SARS-CoV-2 and could be adapted for MVA105L applications in vaccine development.

What peptide microarray approaches are available for epitope mapping of MVA105L?

Peptide microarray technology offers a powerful approach for mapping epitopes within MVA105L. Commercial platforms are available that provide comprehensive coverage of the entire 304 amino acid sequence:

Available Microarray Specifications:

  • Glass slide format: 1" x 3" (2.5 x 7.5cm)

  • Layout: 74 peptides printed in triple spots across four individual subarrays

  • Peptide design: 15/11 peptide scan (15-mer peptides with 11 amino acid overlap)

  • Storage: Refrigerated at +4°C, with 6-month recommended use period

The experimental workflow typically involves:

  • Incubating the microarray with sera or antibodies of interest

  • Washing to remove unbound antibodies

  • Incubating with fluorescently labeled secondary antibodies

  • Scanning with a microarray scanner

  • Data analysis to identify reactive peptides

This approach allows for high-resolution epitope mapping and can identify both linear and partially conformational epitopes within MVA105L, facilitating the design of improved vaccines or diagnostic tools.

How can binding affinity and specificity of MVA105L to cell surfaces be quantitatively assessed?

To quantitatively assess the binding characteristics of MVA105L to cell surfaces, several methodological approaches can be employed:

  • Competitive Binding Assays:

    • Prepare soluble, truncated forms of MVA105L (similar to methods used for L1 protein)

    • Label the protein with a fluorescent tag or radioactive isotope

    • Measure binding to different cell types with and without competitors

    • Assess binding in the presence of glycosaminoglycans (GAGs) to determine GAG-independence

  • Flow Cytometry Protocol:

    • Incubate cells with varying concentrations of labeled MVA105L

    • Wash to remove unbound protein

    • Analyze using flow cytometry to quantify binding

    • Generate saturation binding curves to determine Kd values

  • Surface Plasmon Resonance:

    • Immobilize potential receptors on sensor chips

    • Flow MVA105L over the surface at different concentrations

    • Measure association and dissociation rates

    • Calculate binding affinity constants

When interpreting results, it's important to note that MVA105L, like L1, may bind to cell surfaces independently of glycosaminoglycans (GAGs), suggesting interaction with specific protein receptors rather than ubiquitous cell surface components .

What are the recommended protocols for assessing the functional activity of recombinant MVA105L in virus entry inhibition studies?

For investigating the potential role of MVA105L in virus entry and developing entry inhibition assays, the following protocol is recommended based on studies with related proteins:

  • Preparation of Soluble MVA105L:

    • Express and purify recombinant MVA105L with a His-tag

    • Prepare serial dilutions (typically 0.1-100 μg/ml)

  • Virus Binding Inhibition Assay:

    • Pre-incubate target cells with soluble MVA105L for 30-60 minutes

    • Add vaccinia virus (preferably a reporter virus expressing GFP or luciferase)

    • Incubate for 1-2 hours at 4°C to allow binding but prevent entry

    • Wash cells thoroughly to remove unbound virus

    • Quantify bound virus by fluorescence microscopy, qPCR, or FACS analysis

  • Virus Entry Inhibition Assay:

    • Follow the same procedure as above, but after virus binding, shift cells to 37°C

    • Allow infection to proceed for 6-24 hours

    • Quantify infection by measuring reporter gene expression

    • Compare results in both GAG-deficient and GAG-expressing cells

  • Data Analysis:

    • Calculate IC50 values for inhibition

    • Generate dose-response curves

    • Perform statistical analysis to determine significance

This experimental approach can help determine whether MVA105L functions similar to L1 as a receptor binding protein that can competitively inhibit virus attachment and entry .

What are the common challenges in achieving high purity and proper folding of recombinant MVA105L protein?

Researchers frequently encounter several challenges when working with recombinant MVA105L:

  • Protein Solubility Issues:

    • MVA105L may form inclusion bodies in E. coli expression systems

    • Solution: Optimize expression conditions (lower temperature, reduced IPTG concentration) or use solubility-enhancing tags

  • Protein Folding Challenges:

    • As a cell surface protein, MVA105L contains disulfide bonds that may not form correctly in bacterial systems

    • Solution: Consider expression in eukaryotic systems or use in vitro refolding protocols with controlled redox conditions

  • Purification Complications:

    • Non-specific binding to purification matrices can reduce purity

    • Solution: Optimize imidazole concentrations in both binding and elution buffers when using His-tag purification

  • Storage Stability:

    • Protein aggregation during storage can reduce activity

    • Solution: Add stabilizers such as trehalose (6%) in storage buffer and maintain at pH 8.0

  • Endotoxin Contamination:

    • E. coli-derived proteins often contain endotoxins that can interfere with functional assays

    • Solution: Include endotoxin removal steps in the purification protocol

A systematic approach to these challenges, combined with careful quality control testing (SDS-PAGE, Western blot, activity assays), can significantly improve the quality of recombinant MVA105L preparations.

How can researchers troubleshoot unsuccessful generation of recombinant vaccinia viruses expressing MVA105L?

When attempts to generate recombinant vaccinia viruses expressing MVA105L fail, consider the following troubleshooting approaches:

  • Transfection Efficiency Issues:

    • Problem: Low transfection efficiency leads to rare recombination events

    • Solution: Optimize transfection conditions, try different transfection reagents, or electroporation

  • Recombination Problems:

    • Problem: Insufficient homologous sequence length for recombination

    • Solution: Ensure flanking sequences are at least 500 bp on each side of the MVA105L gene

  • Selection Difficulty:

    • Problem: Selection system not functioning properly

    • Solution: Confirm that selection markers (e.g., XGPRT, TK) are functional and that appropriate selection pressure is being applied

  • Plaque Visualization Challenges:

    • Problem: Difficulty in identifying recombinant plaques

    • Solution: Use live immunostaining for MVA or incorporate visual markers like GFP or β-galactosidase

  • Toxicity of Expressed Protein:

    • Problem: MVA105L expression may be toxic to the virus or host cells

    • Solution: Use inducible promoters or attenuate expression levels

A systematic approach to troubleshooting, combined with appropriate controls (including positive control recombinations with known successful genes), can help identify and address the specific issues hindering successful recombinant virus generation.

How might MVA105L be utilized in next-generation vaccine platforms?

MVA105L presents several promising opportunities for next-generation vaccine development:

  • As a Fusion Partner for Enhanced Immunogenicity:

    • MVA105L could be fused to antigens of interest to enhance their presentation

    • Similar to how trimerization domains have been used with SARS-CoV-2 RBD, MVA105L could serve as both a carrier and immunostimulatory component

  • As a Target for Broadly Protective Poxvirus Vaccines:

    • Being a cell surface protein, antibodies against MVA105L might neutralize virus entry

    • Multi-epitope vaccines incorporating conserved regions of MVA105L along with other surface proteins could provide broader protection

  • As a Platform for Mucosal Immunity Development:

    • Intranasal delivery of recombinant vaccines expressing MVA105L could induce both mucosal and systemic immunity

    • This approach would be particularly valuable for respiratory pathogens, as demonstrated with SARS-CoV-2 vaccines

  • Research Opportunities in Structural Vaccinology:

    • Detailed structural analysis of MVA105L and its interactions with cell receptors

    • Structure-guided design of improved immunogens based on MVA105L epitopes

    • Development of chimeric proteins combining the best epitopes from multiple poxvirus surface proteins

These approaches could significantly advance the field of vaccine design, particularly for vaccines targeting viruses that enter through mucosal surfaces.

What are the current knowledge gaps regarding MVA105L's role in vaccinia virus entry and host-pathogen interactions?

Despite advances in understanding vaccinia virus proteins, several critical knowledge gaps remain regarding MVA105L:

  • Receptor Identity:

    • The specific cellular receptor(s) for MVA105L remain unidentified

    • Research question: Which membrane proteins interact directly with MVA105L?

  • Entry Mechanism:

    • The precise step at which MVA105L functions during viral entry is unclear

    • Research question: Does MVA105L function primarily in attachment, fusion, or another entry stage?

  • Host Range Determination:

    • It's unknown whether MVA105L contributes to host range or tissue tropism

    • Research question: Does MVA105L binding affinity vary across cell types from different species?

  • Structural Insights:

    • High-resolution structures of MVA105L alone or in complex with receptors are lacking

    • Research question: What are the key structural features that mediate MVA105L's binding activities?

  • Immune Evasion:

    • The role of MVA105L in evading host immune responses remains unexplored

    • Research question: Does MVA105L interact with components of the innate immune system?

Addressing these gaps would significantly advance our understanding of poxvirus entry mechanisms and could inform the development of antiviral strategies and improved vaccine vectors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.