Recombinant Vaccinia virus Cell surface-binding protein (TD8L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vaccinia Virus Cell Surface-Binding Protein (TD8L)

The Recombinant Vaccinia virus Cell Surface-Binding Protein (TD8L) is a viral envelope protein expressed by the vaccinia virus (VACV) that facilitates viral entry by binding to chondroitin sulfate (CS) on host cell surfaces. This 304-amino acid protein (UniProt ID: Q9JFA1) plays a critical role in adsorption and infection, as demonstrated by functional studies and mutant virus analyses .

2.1. Protein Structure

PropertyDetails
SourceExpressed in E. coli
TagN-terminal His tag (for purification)
LengthFull-length (1–304 amino acids)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (avoid repeated freeze-thaw cycles)

The protein’s extracellular domain (aa 1–264) is critical for CS binding, while the N-terminal region includes positively charged residues that mediate interaction with anionic CS .

3.1. Role in Viral Entry

TD8L binds specifically to CS, distinct from the A27L protein, which interacts with heparan sulfate (HS). Key experimental evidence includes:

  • Neutralization Studies: Soluble TD8L or anti-TD8L antibodies (e.g., C8 serum) block viral adsorption and infection .

  • Competitive Binding: CS inhibits TD8L-cell surface interaction in a dose-dependent manner, while HS and dermatan sulfate (DS) show minimal or no competition .

3.2. Mutant Virus Analysis

Virus TypeIMV Titer (vs. Control)Infectivity (vs. Control)Binding Efficiency
A27L⁺ D8L⁻10%6–10%Reduced
A27L⁻ D8L⁻10%6–10%Reduced
A27L⁻ D8L⁺NormalNormalNormal

Mutant viruses lacking TD8L exhibit impaired growth in cell culture and reduced infectivity, confirming its essential role in entry .

4.1. Binding Specificity

  • CS Interaction: TD8L binds CS with high specificity, as shown by FACS-based assays where CS (but not HS or DS) displaces the protein from cell surfaces .

  • Structural Dependence: Neutralization by C8 serum (targeting native TD8L) but not D8-1 serum (denatured epitopes) highlights the importance of conformational integrity for binding .

4.2. Mechanistic Insights

TD8L’s binding to CS likely facilitates viral attachment, while A27L’s HS interaction may promote membrane fusion during later infection stages . This dual GAG-binding strategy enhances viral infectivity and host range.

5.1. Research Tools

  • Recombinant Protein: Used in neutralization assays, binding studies, and ELISA kits (e.g., CSB-CF888287Vah) to study CS-TD8L interactions .

  • Mutant Viruses: A27L⁻ D8L⁻ strains serve as models to dissect GAG-dependent entry mechanisms .

5.2. Therapeutic Implications

Understanding TD8L’s role in entry could inform the development of:

  • Antiviral Agents: Targeting CS-TD8L binding to block initial infection.

  • Vaccine Platforms: Leveraging recombinant vaccinia viruses to study immune responses to viral envelope proteins .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us for preferential development.

Synonyms
TD8L; Cell surface-binding protein; Carbonic anhydrase homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Vaccinia virus (strain Tian Tan) (VACV)
Target Names
TD8L
Target Protein Sequence
MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADA VWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTPPARENYFMRWLSDLRETCFSYYQKYIEENKTFAIIAIVFVFILTAILFFMSRRYSR EKQN
Uniprot No.

Target Background

Function

Binds to chondroitin sulfate on the cell surface, mediating virion attachment to the target cell.

Protein Families
Alpha-carbonic anhydrase family
Subcellular Location
Virion membrane.

Q&A

What is the D8L protein and what is its primary function in vaccinia virus?

D8L is an envelope protein found in the intracellular mature virions (IMV) of vaccinia virus that primarily functions as a cell surface attachment protein. Unlike the A27L protein which binds to heparan sulfate, D8L specifically binds to chondroitin sulfate on host cell surfaces. This interaction facilitates virus adsorption and entry into cells, representing an essential early step in the viral infection process. Experimental evidence demonstrates that soluble D8L protein can interfere with the adsorption of wild-type vaccinia virions to cells, confirming its role in virus entry .

How does D8L protein differ from other vaccinia virus attachment proteins?

While vaccinia virus employs multiple proteins for host cell attachment, D8L's specificity for chondroitin sulfate distinguishes it from other attachment proteins like A27L, which binds to heparan sulfate. This specificity is reflected in competitive binding assays where:

GlycosaminoglycanInhibition of D8L Binding
Chondroitin Sulfate (CS)Strong, dose-dependent inhibition
Dermatan Sulfate (DS)Slight inhibition at high concentrations (1,000 μg/ml)
Heparin (HP)No inhibition at any concentration

These distinct binding specificities suggest that vaccinia virus has evolved multiple attachment mechanisms, potentially allowing it to infect a broader range of cell types or providing redundancy in the infection process .

What is the basic structure and localization of D8L protein in vaccinia virions?

D8L is a membrane protein located in the envelope of vaccinia virus IMVs. The protein consists of 304 amino acids, with the recombinant soluble version typically comprising the ectodomain region from amino acid 1 to 264. This extracellular domain contains the binding site for chondroitin sulfate. For research purposes, recombinant D8L is often expressed as a fusion protein with tags (such as T7 tag at the N-terminus and hexahistidine sequences at the C-terminus) to facilitate identification and purification through nickel column chromatography .

What are the functional consequences of D8L gene deletion on vaccinia virus infectivity?

Studies using D8L-deficient mutant viruses reveal significant functional consequences:

Virus TypeIMV Titers (% of control)Infectivity (% of control)Virion Morphology
A27L+ D8L+ (control)100%100%Normal brick shape
A27L- D8L+Similar to controlSimilar to controlNormal brick shape
A27L+ D8L-~10%6-10%Normal brick shape
A27L- D8L-~10%6-10%Normal brick shape

These data demonstrate that D8L deletion significantly reduces viral titers and infectivity without affecting virion morphogenesis. Importantly, A27L protein cannot compensate for D8L's functions, indicating distinct and potentially non-redundant roles in viral entry. Virion binding assays further revealed that D8L-deficient virions bound less efficiently to BSC40 cells, confirming D8L's role in virus attachment to host cells .

How do antibodies against D8L affect neutralization of vaccinia virus infection?

Antibody responses against D8L show variable neutralization capabilities depending on the epitopes recognized. In neutralization studies:

  • Antibodies raised against soluble D8L protein (C8 serum) that recognize native conformational epitopes effectively neutralize vaccinia virus infection

  • Antibodies raised against denatured fusion protein (D8-1 serum) recognizing only linear epitopes fail to neutralize viral infection

This distinction is crucial for vaccine development and immunotherapeutic approaches targeting D8L. The data suggest that antibodies must recognize the native structure of D8L to interfere with its binding to chondroitin sulfate and subsequently block infection. This finding has implications for experimental design when developing vaccines or therapeutic antibodies targeting D8L .

What is the relative contribution of D8L versus A27L in vaccinia virus entry across different cell types?

The relative contribution of D8L versus A27L likely varies across cell types depending on the expression profiles of cell surface glycosaminoglycans. While comprehensive comparative data across multiple cell types is limited in the provided search results, experiments with BSC40 cells indicate that both proteins contribute to viral attachment, but with distinct roles:

  • A27L binds to heparan sulfate and contributes to viral attachment

  • D8L binds to chondroitin sulfate and significantly impacts virus growth in cell culture

  • The combined loss of both proteins results in substantial reduction in viral infectivity

Research investigating the expression patterns of different glycosaminoglycans across cell types would provide insights into the cell-specific contributions of D8L versus A27L to viral entry. This remains an important area for further investigation to understand tissue tropism and pathogenesis .

What are the recommended methods for producing recombinant D8L protein for binding studies?

For producing functional recombinant D8L protein suitable for binding studies, the following methodological approach is recommended:

  • Cloning strategy:

    • Amplify the D8L ectodomain (amino acids 1-264) using PCR with specific primers:

      • 5′ primer: 5′-AAAGAATTCATGCCGCAACAACTATCT

      • 3′ primer: 5′-AAAAAGCTTTGAAAAACATGTCTCTCT

    • Use a PCR program of 94°C for 1 min, 42°C for 1.5 min, and 72°C for 1.5 min for 25 cycles

    • Digest amplified DNA with EcoRI and HindIII

    • Clone into an expression vector (e.g., pET21a) with appropriate tags

  • Protein expression and purification:

    • Express the construct in bacteria with appropriate tags (T7 tag at N-terminus, hexahistidine at C-terminus)

    • Purify using nickel column chromatography

    • Verify purity by SDS-PAGE and Western blotting

  • Functionality testing:

    • Confirm binding activity using cell surface binding assays with appropriate controls

    • Verify native conformation using neutralizing antibodies

This approach yields soluble D8L protein that maintains native conformation and binding activity, making it suitable for studying virus-host interactions and competitive binding assays .

How should researchers design competitive binding assays to study D8L-glycosaminoglycan interactions?

Competitive binding assays for studying D8L-glycosaminoglycan interactions should be designed with the following considerations:

  • Preparation of labeled D8L protein:

    • Biotinylate purified recombinant D8L protein for detection

    • Verify that labeling doesn't interfere with binding activity

  • Experimental setup:

    • Use appropriate cell lines expressing chondroitin sulfate (e.g., BSC40 cells)

    • Pre-incubate cells with varying concentrations of soluble glycosaminoglycans (10, 100, and 1,000 μg/ml)

    • Add biotinylated D8L protein and incubate (typically at 4°C)

    • Wash to remove unbound protein

    • Detect bound D8L using appropriate methods (e.g., flow cytometry with streptavidin-fluorophore)

  • Controls and variables:

    • Include multiple glycosaminoglycan types (chondroitin sulfate, dermatan sulfate, heparin)

    • Include negative controls (cells without competitor)

    • Include irrelevant protein controls with same tags

  • Analysis:

    • Quantify binding inhibition as percentage reduction compared to no-competitor control

    • Generate dose-response curves for each glycosaminoglycan

    • Determine IC50 values for effective competitors

This approach allows for precise characterization of D8L's binding specificity and affinity for different glycosaminoglycans, providing important insights into the molecular basis of vaccinia virus attachment to host cells .

What is the recommended protocol for generating D8L-deficient vaccinia virus mutants?

The generation of D8L-deficient vaccinia virus mutants requires precise genetic manipulation techniques. Based on the provided research, the following protocol is recommended:

  • Construction of recombination plasmid:

    • Create a plasmid containing a selection marker (e.g., lacZ gene) flanked by D8L sequences

    • Example approach: Digest pSC11-5 with SalI and PstI to obtain lacZ cassette under p11K promoter

    • Clone this cassette into a vector containing D8L sequences, ensuring the lacZ cassette disrupts the D8L gene

  • Virus recombination:

    • Transfect the constructed plasmid into permissive cells (e.g., CV-1)

    • Infect the cells with parent virus at low MOI (0.1 PFU/cell)

    • Include appropriate conditions for virus growth (e.g., IPTG at 5 mM if using an inducible system)

    • Harvest virus after 2-3 days

  • Selection and purification:

    • Plate virus on agar containing X-Gal (300 μg/ml) to identify recombinants expressing β-galactosidase

    • Pick blue plaques and repeat plaque purification 3-4 times until pure recombinant virus is obtained

    • Maintain appropriate growth conditions during plaque purification

  • Verification of recombinant virus:

    • Purify viral DNA and perform restriction analysis to confirm lacZ insertion

    • Verify absence of D8L expression by Western blotting

    • Sequence across recombination junctions to confirm integrity

  • Characterization of mutant phenotype:

    • Perform growth curves in multiple cell types

    • Analyze plaque morphology

    • Assess virion binding and entry efficiency

This protocol enables the generation of defined D8L-deficient viruses for studying the role of this protein in viral infection, while the verification steps ensure the specificity and reliability of the mutant viruses for experimental use .

How should researchers interpret conflicting data between in vitro D8L binding assays and in vivo infection results?

When faced with discrepancies between in vitro D8L binding assays and in vivo infection results, researchers should consider several factors in their analysis:

  • Biological complexity factors:

    • Cell type-specific expression of glycosaminoglycans may influence D8L dependency

    • Redundancy in attachment mechanisms might mask D8L contributions in certain systems

    • Differential expression of proteoglycans on different cell surfaces

  • Methodological considerations:

    • Binding assays may use non-physiological conditions (temperature, salt concentration)

    • Recombinant protein may not fully recapitulate the conformational state of virion-associated D8L

    • In vitro binding may not reflect the multivalent interactions that occur during natural infection

  • Analytical approach:

    • Examine dose-responses across multiple experimental systems

    • Consider kinetic parameters rather than endpoint measurements

    • Perform correlation analyses between binding affinity and infection efficiency

  • Reconciliation strategies:

    • Develop more sophisticated models that account for both A27L and D8L contributions

    • Design experiments that systematically vary receptor density and distribution

    • Use live-cell imaging to track binding and entry events in real-time

The research shows that while D8L-deficient viruses retain some infectivity (6-10%), this partial activity likely reflects the contribution of other attachment proteins like A27L. The integration of multiple approaches provides the most comprehensive understanding of D8L's role in virus entry .

What statistical approaches are recommended for analyzing D8L binding and infectivity data?

When analyzing D8L binding and infectivity data, researchers should employ rigorous statistical approaches tailored to the specific experimental design:

  • For binding assays:

    • Use non-linear regression to fit binding curves and determine affinity constants

    • Apply analysis of variance (ANOVA) to compare binding across different conditions

    • Calculate confidence intervals around EC50 values for competitive binding assays

    • Consider Scatchard or Hill plot analyses for characterizing binding parameters

  • For infectivity studies:

    • Employ appropriate transformations (e.g., log transformation) if data show non-normal distribution

    • Use paired statistical tests when comparing mutant viruses to parent virus

    • Calculate relative infectivity with propagated error from multiple experiments

    • Consider regression analysis to correlate binding efficiency with infectivity

  • For multivariable experiments:

    • Apply multivariate analysis when examining the effects of multiple factors

    • Consider mixed-effects models for experimental designs with repeated measures

    • Use appropriate post-hoc tests with correction for multiple comparisons

  • Reporting standards:

    • Report both absolute and relative values with appropriate measures of variability

    • Include sample sizes and power calculations

    • Present raw data alongside derived metrics when possible

How can researchers differentiate between D8L binding effects and post-binding entry effects in infection assays?

Distinguishing between D8L's role in initial binding versus potential contributions to post-binding events requires carefully designed experiments that separate these phases of infection:

  • Time-course binding assays:

    • Perform synchronized infection at 4°C (permits binding but not entry)

    • Measure bound virus using quantitative PCR or immunofluorescence

    • Compare binding kinetics between wild-type and D8L-deficient viruses

    • Wash unbound virus and shift to 37°C to permit entry

  • Entry-specific assays:

    • Use electron microscopy to track virion localization relative to plasma membrane

    • Employ fluorescently labeled virions to visualize fusion events

    • Measure early gene expression as a marker of successful entry

  • Binding-bypass experiments:

    • Artificially attach virions to cells using alternative methods (e.g., anti-virus antibodies bound to cell surface receptors)

    • Compare subsequent infection efficiency between wild-type and D8L-deficient viruses

    • If differences persist after equalized binding, this suggests post-binding roles

  • Inhibitor studies:

    • Use compounds that specifically block certain entry pathways

    • Compare sensitivity of wild-type versus D8L-deficient viruses to these inhibitors

    • Differential sensitivity may indicate involvement in specific entry mechanisms

How might insights about D8L binding inform the development of antiviral strategies against poxviruses?

Understanding D8L's structure and binding mechanisms provides several strategies for antiviral development:

  • Small molecule inhibitors:

    • Design compounds that mimic chondroitin sulfate structure to competitively inhibit D8L binding

    • Develop allosteric inhibitors that alter D8L conformation and prevent receptor recognition

    • Create dual-targeting inhibitors that simultaneously block both D8L and A27L binding

  • Protein-based therapeutics:

    • Develop soluble D8L protein as a competitive inhibitor of virus binding

    • Engineer high-affinity chondroitin sulfate mimetics that outcompete virus for binding

    • Create antibody therapeutics targeting the binding domain of D8L

  • Host-directed approaches:

    • Modulate cell surface glycosaminoglycan expression or sulfation patterns

    • Target enzymes involved in chondroitin sulfate biosynthesis

    • Develop peptides that mask chondroitin sulfate on cell surfaces

  • Combination strategies:

    • Target multiple viral attachment proteins simultaneously (D8L, A27L, and others)

    • Combine attachment inhibitors with entry or replication inhibitors for synergistic effects

The research demonstrates that soluble D8L protein can effectively interfere with vaccinia virus binding to cells in a dose-dependent manner, providing proof-of-concept for competitive inhibition strategies. Additionally, antibodies recognizing native D8L epitopes (like the C8 serum) can neutralize virus infection, supporting antibody-based therapeutic approaches .

What are the implications of D8L-chondroitin sulfate interactions for vaccinia virus tropism and pathogenesis?

The specific interaction between D8L and chondroitin sulfate has significant implications for understanding vaccinia virus tissue tropism and pathogenesis:

  • Tissue-specific infection patterns:

    • Tissues with high chondroitin sulfate expression may be more susceptible to infection

    • The distribution and specific sulfation patterns of chondroitin sulfate across tissues could influence viral dissemination

    • Differential expression of chondroitin sulfate proteoglycans during development or inflammation may alter susceptibility

  • Evolutionary considerations:

    • The conservation of D8L across poxviruses suggests strong selective pressure for chondroitin sulfate binding

    • The presence of multiple attachment proteins (D8L and A27L) indicates evolutionary adaptation to utilize diverse cell surface molecules

  • Pathogenesis mechanisms:

    • D8L-mediated binding may trigger specific signaling pathways affecting subsequent infection events

    • The affinity of D8L for chondroitin sulfate may influence the efficiency of infection in different anatomical sites

    • Competition with host factors that normally bind chondroitin sulfate could disrupt normal tissue function

  • Host range determination:

    • Species-specific differences in chondroitin sulfate structure or distribution might influence host range

    • D8L binding preferences may partially explain the tropism of different poxvirus strains

The research shows that D8L-deficient viruses exhibit substantially reduced infectivity in BSC40 cells, demonstrating the importance of this interaction in cellular infection. Further studies across diverse cell types and tissues would provide deeper insights into how D8L-chondroitin sulfate interactions shape vaccinia virus pathogenesis .

What are the key unanswered questions regarding D8L structure-function relationships?

Several critical questions about D8L structure-function relationships remain to be addressed:

  • Binding domain characterization:

    • What is the precise 3D structure of D8L's chondroitin sulfate binding domain?

    • Which specific amino acid residues directly interact with chondroitin sulfate?

    • How does glycosylation of D8L influence its binding properties?

  • Binding specificity determinants:

    • What structural features of chondroitin sulfate are recognized by D8L?

    • Does D8L preferentially bind specific sulfation patterns or chain lengths?

    • How does the affinity of D8L for chondroitin sulfate compare across different poxviruses?

  • Functional integration:

    • How does D8L cooperate with other attachment proteins during viral entry?

    • Is there a sequential binding model involving multiple attachment proteins?

    • Does D8L play any role beyond initial attachment, such as signaling or fusion triggering?

  • Conformational dynamics:

    • Does D8L undergo conformational changes upon binding to chondroitin sulfate?

    • How is D8L organized on the virion surface relative to other attachment proteins?

    • Do mutations in D8L that affect binding also impact virion assembly or stability?

Future research employing techniques such as cryo-electron microscopy, X-ray crystallography, and advanced spectroscopic methods would help resolve these questions and provide a more comprehensive understanding of D8L's role in vaccinia virus infection .

How might advanced technologies improve our understanding of D8L-mediated virus attachment?

Emerging technologies offer promising approaches to advance our understanding of D8L-mediated attachment:

  • Single-molecule techniques:

    • Single-particle tracking to observe individual D8L-chondroitin sulfate binding events

    • Atomic force microscopy to measure binding forces between D8L and its receptor

    • Single-molecule FRET to detect conformational changes during binding

  • Advanced imaging:

    • Super-resolution microscopy to visualize the distribution of D8L on virion surfaces

    • Correlative light-electron microscopy to track binding and entry events with nanometer precision

    • Live-cell imaging with labeled D8L to observe dynamics of attachment in real-time

  • Structural biology approaches:

    • Cryo-electron tomography of virus-cell binding interfaces

    • High-resolution X-ray crystallography of D8L-chondroitin sulfate complexes

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

  • Systems biology integration:

    • Proteomics analysis of D8L interaction partners during different stages of infection

    • Computational modeling of multivalent attachment through multiple viral proteins

    • Machine learning approaches to identify patterns in experimental data

These technologies would complement traditional approaches and provide unprecedented insights into the molecular mechanisms of D8L-mediated attachment, potentially revealing new targets for antiviral intervention and advancing our fundamental understanding of virus-host interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.