Recombinant Vaccinia virus Envelope protein H3 (H3L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
H3L; Envelope protein H3; Ag35; Virion envelope protein p35
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-324
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
H3L
Target Protein Sequence
MAAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMPEKRNVVVVKDDPDHYK DYAFIQWTGGNIRNDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSNFFTELENKKVEY VVIVENDNVIEDITFLRPVLKAMHDKKIDILQMREIITGNKVKTELVMDKNHTIFTYTGG YDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQILDNAAKYVEHD PRLVAEHRFENMKPNFWSRIGTAAAKRYPGVMYAFTTPLISFFGLFDINVIGLIVILFIM FMLIFNVKSKLLWFLTGTFVTAFI
Uniprot No.

Target Background

Function
This envelope protein binds to heparan sulfate on the cell surface, potentially mediating virion attachment to target cells.
Protein Families
Chordopoxvirinae protein H3 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the H3L protein and what is its significance in poxvirus research?

    H3L is a 324-amino-acid immunodominant membrane component of vaccinia virus particles, expressed late in infection and accumulated in cytoplasmic viral factory regions. It is a major envelope protein of intracellular mature virions (IMV) . The protein has gained significance in research because it mediates virus adsorption to cell surface heparan sulfate, playing a critical role in virus entry and infectivity . Additionally, H3L is a major target of neutralizing antibodies, making it relevant for vaccine development and immunological studies . Recent studies have expanded its significance by revealing that H3L exhibits a glycosyltransferase fold and binds UDP-glucose, suggesting enzymatic functions beyond structural roles . Furthermore, monkeypox virus H3L has been shown to induce tissue injuries through transcriptional perturbations, highlighting its potential role in pathogenesis .

  • What is the structure and localization of the H3L protein?

    The crystal structure of H3L from vaccinia virus resolved at 1.9-Å resolution reveals that it exhibits a glycosyltransferase fold . The protein contains a glycosyltransferase-like metal ion binding motif that is essential for UDP-glucose binding, which requires Mg²⁺ . H3L is primarily localized on the surfaces of viral particles, specifically on the envelope of intracellular mature virions (IMV). It is anchored to the membrane via its hydrophobic C-terminal tail . This localization has been confirmed through multiple experimental approaches, including its extraction by NP-40 in the absence of reducing agents, trypsin sensitivity, reactivity with membrane-impermeable biotinylation reagents, and immunogold labeling with antibodies to specific peptide regions . Biochemical studies have demonstrated that H3L synthesized in a coupled in vitro transcription/translation system is tightly anchored to membranes, further confirming its membrane association .

  • How does H3L contribute to viral infection and host cell interactions?

    H3L plays several critical roles in poxvirus infection:

    • Cell Attachment: H3L mediates virus adsorption to cell surface heparan sulfate, as demonstrated by competition experiments where soluble H3L protein binds to heparan sulfate and competes with vaccinia virus binding .

    • Virion Morphogenesis: Mutant viruses defective in H3L expression (H3L⁻) show severe blocks in virion morphogenesis, with accumulation of intermediate viral structures such as viral factories and crescents in infected cells .

    • Viral Replication: H3L⁻ mutant viruses exhibit a small plaque phenotype and produce 10-fold lower IMV and extracellular enveloped virion titers compared to wild-type virus .

    • Virulence: Mice inoculated intranasally with H3L⁻ mutant virus show higher survival rates and faster recovery compared to those infected with wild-type virus, indicating that H3L contributes significantly to virulence in vivo .

    Flow cytometry experiments have shown that H3L binds to the surface of human cells but does not bind well to cells deficient in surface glycosaminoglycans, confirming its interaction with these cell surface molecules . Saturation Transfer Difference (STD) NMR experiments using a heparin sulfate decasaccharide have further confirmed that H3L binds heparin sulfate .

  • What methods are used to express and purify recombinant H3L protein?

    Researchers typically employ the following methodology to produce recombinant H3L protein:

    1. Gene Cloning: The H3L gene is amplified from vaccinia virus DNA using PCR with primers containing appropriate restriction sites. For example, a study used primers containing NcoI and BamHI sites at the respective 5′ and 3′ ends to generate the H3L gene .

    2. Vector Construction: The amplified gene is cloned into an expression vector such as pVOTE.1 .

    3. Expression System: The recombinant protein can be expressed in various systems, though bacterial expression in E. coli is commonly used for initial studies.

    4. Purification: The protein is typically purified using affinity chromatography, often with a His-tag system.

    5. Validation: Quality control includes SDS-PAGE, Western blotting, and functional assays to verify the integrity and activity of the purified protein.

    For immunization studies, recombinant H3L protein has been emulsified in Freund's complete adjuvant for initial doses, with booster doses administered using incomplete Freund's adjuvant (typically 200 μg H3L/dose) . This approach has been successful in generating neutralizing antibodies in mice and rabbits.

Intermediate Research Questions

  • How does H3L function as a target for neutralizing antibodies?

    H3L has been identified as a major target of neutralizing antibodies against poxviruses, with significant implications for vaccine development. Key findings include:

    • Human Recognition: H3L is recognized by human vaccinia immunoglobulin (VIG) with a 50% neutralization concentration (IC₅₀) of 44 μg/ml .

    • Immunodominance: Mice develop an immunodominant antibody response to H3L after vaccination with vaccinia virus, as determined by vaccinia virus protein microarray .

    • Neutralizing Capacity: Mice immunized with recombinant H3L protein develop high-titer vaccinia virus-neutralizing antibodies with a mean plaque reduction neutralization titer (PRNT₅₀) of 1:3,760 .

    • Protective Efficacy: H3L-immunized mice are protected against lethal intranasal challenges with 1 or 5 LD₅₀ (50% lethal doses) of pathogenic vaccinia virus strain WR .

    • Passive Protection: In passive transfer experiments, mice receiving H3L-neutralizing antiserum showed significant protection from lethal challenge with 3 LD₅₀ of vaccinia virus strain WR (50% survival vs. 0% in controls) .

    These findings collectively demonstrate that H3L is not only immunogenic but also elicits functionally relevant antibodies that can provide protection against poxvirus infection, highlighting its potential as a vaccine antigen.

  • What are the differences in H3L function between various poxviruses?

    While H3L is conserved across poxviruses, recent research has revealed significant functional differences between vaccinia virus and monkeypox virus H3L proteins:

    FeatureVaccinia Virus H3LMonkeypox Virus H3L
    Primary FunctionMediates virus adsorption to cell surface heparan sulfate Induces transcriptional perturbations and tissue injuries
    Cellular LocalizationPrimarily on virion envelope Both cytoplasmic and nuclear
    Host InteractionsBinds glycosaminoglycans Binds to promoters of host genes
    Pathogenic EffectsContributes to virulence through viral entry and replication Disrupts cardiac development by altering gene expression
    Epigenetic EffectsNot reportedRemodels histone modifications (H3K27me3 and H3K4me3)

    These differences highlight the divergent evolution of H3L function across poxviruses, with monkeypox virus H3L exhibiting additional mechanisms that may contribute to its specific pathogenesis. Understanding these distinctions is crucial for developing targeted countermeasures against different poxvirus infections.

  • How does H3L interact with cell surface glycosaminoglycans?

    H3L interacts with cell surface glycosaminoglycans through specific molecular mechanisms:

    • Binding Specificity: H3L specifically binds to heparan sulfate on the cell surface, as demonstrated by competition studies where soluble H3L protein competes with the binding of vaccinia virus .

    • Structural Basis: The crystal structure of H3L reveals a surface with excess positive charge that may serve as the binding site for heparin, which is consistent with the electrostatic interaction between positively charged protein residues and negatively charged sulfate groups on heparan sulfate .

    • Experimental Validation: Flow cytometry experiments have shown that H3L binds to the surface of human cells but does not bind well to cells deficient in surface glycosaminoglycans . This finding was further confirmed by Saturation Transfer Difference (STD) NMR experiments using a heparin sulfate decasaccharide .

    • Functional Significance: This interaction is crucial for virus adsorption to mammalian cells, as evidenced by reduced infectivity of H3L-deficient mutant viruses . The binding of H3L to cell surface heparan sulfate likely represents the initial step in the virus attachment process, facilitating subsequent entry and infection.

    This glycosaminoglycan-binding property of H3L provides a potential target for antiviral interventions that could block the initial virus-host cell interaction.

  • What is the significance of H3L's glycosyltransferase fold and UDP-glucose binding?

    The discovery that H3L exhibits a glycosyltransferase fold and binds UDP-glucose has significant implications for understanding its function:

    • Structural Homology: Crystal structure analysis at 1.9-Å resolution revealed that H3L resembles glycosyltransferases, a family of enzymes that transfer carbohydrate molecules to various acceptor substrates .

    • Cofactor Requirements: Like glycosyltransferases, H3L binds UDP-glucose in a Mg²⁺-dependent manner, as demonstrated by saturation transfer difference (STD) NMR spectroscopy .

    • Metal Binding Motif: H3L contains a glycosyltransferase-like metal ion binding motif that is essential for UDP-glucose binding. Mutation of this motif greatly diminishes its ability to bind UDP-glucose .

    • Functional Implications: This enzymatic capability suggests that H3L may modify carbohydrates on viral or cellular proteins during infection, potentially altering host-virus interactions or immune recognition.

    • Evolutionary Significance: The conservation of this enzymatic fold suggests an important role in the poxvirus life cycle that has been maintained through evolution.

    The glycosyltransferase activity of H3L represents a novel aspect of poxvirus biology that may contribute to viral pathogenesis and provides a potential target for antiviral drug development focused on inhibiting this enzymatic function.

Advanced Research Questions

  • How does H3L induce cardiac developmental disruption in monkeypox virus infection?

    Recent research has revealed a novel mechanism by which monkeypox virus H3L disrupts cardiac development:

    1. Transcriptional Dysregulation: RNA-seq analysis demonstrated that H3L significantly downregulates genes involved in heart morphogenesis and cardiac muscle development .

    2. Repression of Key Cardiac Factors: RT-qPCR confirmed that H3L decreases expression levels of critical mesodermal inducers (MESP1, TBXT) and cardiogenic genes (GATA4, NKX2-5, TBX5) .

    3. Cellular Differentiation Inhibition: H3L decreased the percentage of TBXT+ and TNNT2+ cells, indicating inhibition of mesoderm differentiation and cardiomyocyte specification .

    4. Epigenetic Mechanism: ChIP-seq revealed that H3L binds to promoters of cardiac development genes, including GATA4 and NKX2-5 .

    5. Histone Modification: H3L binding results in increased H3K27me3 (a repressive mark) and reduced H3K4me3 (an activating mark) on these promoters, altering their transcriptional state .

    This mechanism represents a significant finding in poxvirus pathogenesis, demonstrating how a viral protein can directly modify host gene expression through epigenetic remodeling, with specific consequences for tissue development and function. The cardiac developmental disruption induced by H3L may contribute to the systemic effects and complications observed in monkeypox infections.

  • What approaches are used to develop deimmunized vaccinia viral vectors targeting H3L?

    Developing deimmunized vaccinia viral vectors targeting H3L involves systematic approaches to reduce immunogenicity while maintaining functionality:

    1. B-cell Epitope Mapping:

      • A complete panel of overlapping synthetic peptide fragments spanning the full H3L sequence is synthesized

      • Peptides are tested for immune recognition using in vitro ELISA with polyclonal anti-vaccinia viral antibodies

      • Immunogenic peptides are identified for further modification

    2. Alanine Scanning Mutagenesis:

      • Identified immunogenic peptides undergo alanine scanning mutagenesis

      • Modified peptides are retested for immune recognition

      • Mutations that reduce antibody binding while preserving protein function are identified

    3. Deimmunized H3L Engineering:

      • Confirmed deimmunizing mutations are engineered back into the H3L viral proteins

      • Modified proteins are tested for viral packaging, production, stability, and activity

    4. Mutant Library Screening:

      • Mutant virus libraries are generated and screened for neutralization escape mutants

      • Variants with reduced immunogenicity but maintained function are selected

    These approaches aim to mask the virus from neutralizing antibody responses by eliminating B-cell epitopes on the viral membrane proteins while preserving the essential functions of H3L in the viral life cycle. Such deimmunized vectors could have applications in repeated vaccine administration or gene therapy, where pre-existing immunity might otherwise limit efficacy.

  • How can neutralizing antibodies against H3L be characterized and optimized for therapeutic applications?

    Characterizing and optimizing neutralizing antibodies against H3L for therapeutic applications involves several methodological approaches:

    1. Neutralization Potency Assessment:

      • Plaque Reduction Neutralization Tests (PRNT) measure the ability of antibodies to reduce viral infectivity

      • Studies show H3L-immunized mice develop high-titer neutralizing antibodies with a mean PRNT₅₀ of 1:3,760

      • Neutralization activity is assessed against different poxvirus strains to determine breadth of protection

    2. In Vivo Protection Studies:

      • Passive transfer experiments evaluate protective efficacy

      • In published studies, mice receiving H3L-neutralizing antiserum showed 50% protection from lethal challenge with vaccinia virus (vs. 0% in controls)

      • Protection is assessed against different challenge doses and routes of infection

    3. Epitope Mapping:

      • Peptide arrays or alanine scanning mutagenesis identify specific binding sites

      • Structural analysis using X-ray crystallography or cryo-EM visualizes antibody-antigen interactions

      • Understanding epitopes guides antibody engineering for improved binding

    4. Affinity Optimization:

      • Directed evolution approaches select for variants with enhanced binding properties

      • Site-directed mutagenesis targets complementarity-determining regions (CDRs)

      • Affinity measurements using surface plasmon resonance quantify improvements

    5. Therapeutic Modification:

      • Humanization reduces immunogenicity for clinical applications

      • Fc engineering enhances effector functions or extends half-life

      • Bispecific formats target multiple epitopes simultaneously

    These approaches provide a comprehensive framework for developing optimized antibodies against H3L with improved therapeutic potential for treating poxvirus infections.

  • What epigenetic mechanisms does H3L employ to modify host gene expression?

    H3L modifies host gene expression through sophisticated epigenetic mechanisms:

    1. Nuclear Localization: While H3L primarily localizes in the cytoplasm, it also partially localizes in the nucleus, where it can directly influence gene transcription .

    2. Promoter Binding: ChIP-seq analysis has demonstrated that H3L can bind to the promoters of specific genes, particularly those controlling cardiac development . ChIP-qPCR confirmed the occupancy of promoters of cardiogenic inducers/transcription factors (GATA4, NKX2-5) by H3L .

    3. Histone Modification Alterations:

      • H3L binding to promoters results in increased H3K27me3 (trimethylation of lysine 27
        on histone H3), a well-established mark of transcriptional repression

      • Concurrently, H3L binding leads to reduced H3K4me3 (trimethylation of lysine 4 on histone H3), which normally marks active transcription

    4. Gene Expression Consequences: These epigenetic changes directly correlate with downregulation of critical developmental genes and upregulation of genes associated with cell death .

    5. Mechanism Specificity: H3L appears to target specific gene sets, as evidenced by the enrichment of H3L binding at promoters of genes controlling cardiac development and cell death pathways .

    This epigenetic reprogramming represents a sophisticated viral strategy to manipulate host cell functions and may contribute significantly to poxvirus pathogenesis. The ability of H3L to directly modify the host epigenome reveals a novel mechanism by which viral proteins can exert long-lasting effects on host cell gene expression beyond traditional virus-host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.