Recombinant Vaccinia virus Hemagglutinin (HA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
HA; A56R; Protein A56; Hemagglutinin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-315
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain IHD-J) (VACV)
Target Names
HA
Target Protein Sequence
TPFPQTSKKIGDDATLSCNRNNTNDYVVMSAWYKEPNSIILLAAKSDVLYFDNYTKDKIS YDSPYDDLVTTITIKSLTARDAGTYVCAFFMTSTTNDTDKVDYEEYSTELIVNTDSESTI DIILSGSTHSPETSSEKPEDIDNFNCSSVFEIATPEPITDNVEDHTDTVTYTSDSINTVS ASSGESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDTYNDNDT VPPTTVGGSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYYIYNKRSRKYKTENKV
Uniprot No.

Target Background

Function

This protein prevents cell-to-cell fusion by interacting with and targeting the viral K2 protein on the host plasma membrane. The A56-K2 complex associates with entry fusion complex (EFC) components, likely preventing superinfection and syncytium formation. Through interaction with the C3/VCP protein, it protects the infected cell and potentially the extracellular enveloped virus from complement attack.

Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host membrane; Single-pass type I membrane protein. Note=Component of extracellular enveloped virus (EEV) but not intracellular mature virus (IMV). Component of the outermost membrane of EEV.

Q&A

What is the vaccinia virus hemagglutinin and how does it function in viral infection?

The vaccinia virus hemagglutinin (HA) is a glycoprotein found on the plasma membrane of infected cells and the envelope of extracellular virus. It exists in two forms detected by immunoblot analysis: 85 kDa and 68 kDa forms. The 85-kDa HA appears early in infection and accumulates throughout, while the 68-kDa form appears only later in the infection cycle .

Functionally, the VVHA is a novel member of the immunoglobulin superfamily. Its deduced amino acid sequence contains one Ig-like domain at the NH2 terminus, followed by two tandem repeating units and a hydrophobic region that likely serves as a membrane-spanning domain. This structure suggests an evolutionary and functional relationship with other immunoglobulin superfamily members, indicating that vaccinia virus may have captured cellular Ig-related genes .

How is the vaccinia virus hemagglutinin gene expressed and regulated?

The expression of the vaccinia virus hemagglutinin gene follows a complex pattern. The HA gene is transcribed early to yield a 1.65-kb dicistronic early transcript, consisting of the 945-bp HA open reading frame (ORF) fused to a 453-bp downstream ORF. Transcription initiates 7 bases upstream of the AUG initiating codon of the HA ORF .

The regulation occurs at multiple levels:

  • Transcripts originating from the early promoter are found throughout the infection cycle

  • After DNA replication, transcription from a second, late promoter begins

  • The late promoter's transcriptional start site is within a consensus TAAATG sequence 135 bases upstream of the first promoter's start site

  • Production of the 68-kDa HA (but not the 85-kDa HA) can be inhibited by cytosine arabinoside or rifampin

This temporal regulation ensures the proper expression of the HA protein throughout the viral lifecycle.

What techniques are commonly used to detect expression of recombinant hemagglutinin in vaccinia virus-infected cells?

Several techniques are used to detect and characterize recombinant hemagglutinin expression:

  • Western blotting: Using specific antibodies such as sheep antiserum against influenza strains (e.g., A/Vietnam/1194/04). For vaccinia virus protein detection, polyclonal rabbit anti-vaccinia virus serum is commonly used. Secondary antibodies typically include alkaline phosphatase-conjugated IgG .

  • Hemagglutination assay: Measures the ability of the expressed HA to agglutinate red blood cells, which is particularly important for influenza HA proteins .

  • Hemagglutination inhibition (HI) assay: Detects serum antibodies that prevent agglutination of red blood cells by HA molecules, commonly used to assess immunogenicity of HA-expressing vaccines .

  • Immunofluorescence: To visualize cellular localization of expressed HA proteins.

  • Flow cytometry: For quantitative assessment of cell surface expression.

What are the differences between replicating and nonreplicating vaccinia virus vectors for expressing hemagglutinin, and how do they impact experimental outcomes?

Replicating and nonreplicating vaccinia virus vectors exhibit significant differences that impact experimental outcomes:

Nonreplicating vectors (e.g., dVV vectors):

  • Express exclusively early antigens for a prolonged period

  • Show reduced expression of vaccinia virus structural proteins

  • Under nonpermissive conditions, demonstrate better processing of target proteins

  • Are advantageous when vector structural proteins might divert the immune system to unwanted targets

  • Can be used safely in immunocompromised hosts

Replicating vectors (e.g., rVV vectors):

This is evident from Western blot analyses showing that infection of nonpermissive Vero cells with defective virus at a high MOI results in efficient HA expression but low vaccinia virus antigen expression. Conversely, permissive infections induce strong vaccinia virus-specific bands .

How does expression of influenza hemagglutinin in vaccinia vectors contribute to cytotoxic T-lymphocyte responses?

Vaccinia virus recombinants expressing influenza hemagglutinin can both prime and stimulate specific cytotoxic T-lymphocyte (CTL) responses. The mechanisms involve:

  • Presentation of HA-derived peptides on MHC class I molecules of infected cells

  • Recognition of these complexes by specific CD8+ T cells

  • Activation and proliferation of HA-specific CTLs

  • Establishment of memory CTL responses that can be rapidly mobilized upon subsequent exposure

Histocompatible cells infected with recombinant vaccinia expressing influenza HA also serve as targets for CTLs, making this system valuable for studying cell-mediated immunity. This dual ability to induce both humoral and cellular immunity enhances the attractiveness of vaccinia vectors for vaccine production .

What factors influence the processing and presentation of hemagglutinin expressed by recombinant vaccinia virus?

Several factors influence the processing and presentation of hemagglutinin:

  • Promoter selection: The choice of vaccinia virus promoter (early, intermediate, or late) affects the timing and level of HA expression.

  • Cell type: Different cell types process and present antigens with varying efficiency. For example, Vero cells have been shown to properly cleave HA, consistent with excellent growth of wildtype H5N1 influenza virus strains in this cell line .

  • Vector replication competence: In nonreplicating vectors under nonpermissive conditions, better processing and strongly reduced amounts of vaccinia virus structural proteins are observed compared to replicating vectors .

  • Post-translational modifications: Glycosylation patterns affect HA processing and antigenicity. For instance, the N154S(HA2) mutation in some H5N1 strains results in the loss of a potential glycosylation site in the HA2 molecule, which may affect processing .

  • Proteolytic cleavage: The ability of host proteases to cleave HA into HA1 and HA2 subunits affects functionality and immunogenicity.

FactorImpact on HA ProcessingResearch Implication
Promoter selectionDetermines timing and level of expressionCritical for designing temporal expression patterns
Cell typeAffects proper cleavage and glycosylationImportant for in vitro studies and vaccine production
Vector replicationInfluences processing efficiencyKey consideration for vaccine design
GlycosylationAlters antigenicity and receptor bindingAffects cross-reactivity and protective immunity
Proteolytic cleavageRequired for HA activationEssential for functional studies

What are the key steps in constructing a recombinant vaccinia virus expressing hemagglutinin?

Construction of recombinant vaccinia virus expressing hemagglutinin involves these key methodological steps:

  • Cloning the HA gene: Obtain a DNA copy of the influenza virus hemagglutinin gene and place it downstream of a vaccinia virus promoter (e.g., early vaccinia virus promoter) .

  • Plasmid construction: Create a transfer plasmid containing the HA gene flanked by vaccinia virus sequences for homologous recombination. For example:

    • For dVV-HA5, the plasmid pDW2-mH5-HA5 was constructed

    • For rVV-HA5, the plasmid pDD4-mH5-HA5 was used

  • Cell infection and transfection: Infect cells (e.g., CV-1 or Vero cells) with parent vaccinia virus, then transfect with the constructed plasmid. Common methods include:

    • Calcium phosphate precipitation

    • Effectene reagents (Qiagen)

  • Recombinant virus selection:

    • For defective recombinants, selection markers like guanine phosphoribosyl transferase gene (gpt) and lacZ are used

    • Multiple rounds of plaque purification are required (typically 3-4 rounds)

    • For defective viruses, plaque purification in complementing cell lines (e.g., RK44 cells for D4R-deficient viruses)

  • Verification: Confirm successful recombination and HA expression through:

    • PCR and sequencing

    • Western blotting using specific antibodies

    • Functional assays for HA activity

What approaches can be used to optimize hemagglutinin expression in vaccinia virus vectors?

Several approaches can enhance hemagglutinin expression in vaccinia vectors:

  • Promoter optimization: Using strong synthetic promoters like the modified H5 (mH5) promoter, which provides robust early/late expression .

  • Codon optimization: Adjusting codons to match the preferred codon usage of mammalian cells can significantly increase expression levels.

  • Signal sequence modification: Optimizing the signal peptide sequence can improve HA trafficking and cell surface expression.

  • Vector backbone selection: Choosing between replicating and nonreplicating vectors based on experimental needs:

    • For high-level expression in vitro, replicating vectors may be preferred

    • For in vivo applications where safety is paramount, nonreplicating vectors are advantageous

  • Cell line selection: Using complementing cell lines for defective viruses (e.g., cVero cells or RK44 cells) can maximize yield .

  • Infection conditions optimization:

    • MOI adjustment: Higher MOI (e.g., 5.0) for defective vectors

    • Timing of harvest: Typically 72 hours post-infection for optimal HA expression

How can researchers assess the immunogenicity of recombinant vaccinia-expressed hemagglutinin in animal models?

Assessment of immunogenicity involves multiple complementary approaches:

  • Antibody response evaluation:

    • Hemagglutination inhibition (HI) assay: Detects antibodies that prevent agglutination of red blood cells by HA. MVA vectors encoding H1 HA proteins have been shown to induce detectable HI antibody responses within 2 weeks of first immunization, with 2- to 16-fold boosts after second administration .

    • Microneutralization assay: Measures antibodies that neutralize virus infectivity.

    • ELISA: Quantifies total binding antibodies.

  • Cellular immunity assessment:

    • T-cell proliferation assays

    • Cytokine production measurement

    • Cytotoxic T-lymphocyte assays: Vaccinia virus recombinants expressing influenza HA have been shown to prime and stimulate specific CTL responses .

  • Challenge studies:

    • Vaccinated animals are challenged with live influenza virus

    • Protection is assessed by measuring:

      • Viral load in lungs post-challenge (e.g., on days 2 and 4)

      • Clinical signs and symptoms

      • Survival rates

For example, in a study using MVA expressing HA from A/California/7/09 (CA/09) virus, systemic immunization of mice elicited cross-protective immunity against Eurasian "avian-like" H1N1 swine viruses. This protection correlated with cross-reactive HI antibody levels and depended on the similarity of antigenic site Sa of H1 HAs .

What are the key differences between the two forms of vaccinia virus hemagglutinin (85 kDa and 68 kDa), and how do they impact experimental design?

The 85 kDa and 68 kDa forms of vaccinia virus hemagglutinin have distinct characteristics that impact experimental design:

Characteristic85 kDa HA68 kDa HAExperimental Impact
Timing of appearanceEarly in infectionLate in infectionAffects timing of sample collection
Accumulation patternThroughout infectionOnly late in cycleInfluences experimental duration
Sensitivity to inhibitorsResistant to cytosine arabinoside and rifampinInhibited by cytosine arabinoside and rifampinImportant for distinguishing forms experimentally
Hemagglutination activityLess detectableAssociated with peak activityCritical for functional assays

These differences necessitate careful experimental planning:

  • For early events, focus on the 85 kDa form

  • For functional hemagglutination studies, later time points capturing the 68 kDa form may be optimal

  • Inhibitor studies can be used to selectively block 68 kDa HA formation

  • Both forms should be monitored when assessing complete HA expression kinetics

How does the molecular structure of vaccinia virus hemagglutinin relate to its immunological properties?

The molecular structure of vaccinia virus hemagglutinin significantly influences its immunological properties:

  • Immunoglobulin superfamily membership: VVHA contains one Ig-like domain at the NH2 terminus, suggesting evolutionary and functional relationships with other immunoglobulin superfamily members involved in immune recognition .

  • Tandem repeating units: Following the Ig-like domain, VVHA contains two tandem repeating units that may contribute to its antigenic properties .

  • Membrane anchoring: The hydrophobic region likely serves as a membrane-spanning domain, enabling the protein to be expressed on infected cell surfaces and incorporated into virions .

This structure suggests VVHA may function in:

  • Cell-to-cell recognition during infection

  • Viral attachment to host cells

  • Immune evasion strategies

  • Recognition by host immune receptors

The structural similarity to immunoglobulin proteins suggests viral capture of cellular Ig-related genes, indicating that usage of Ig-like domains as recognition signals extends from higher animals to animal viruses .

What considerations are important when designing cross-protection studies using recombinant vaccinia-expressed hemagglutinin?

When designing cross-protection studies, several key factors must be considered:

  • Antigenic site comparison: The similarity of antigenic sites (particularly site Sa for H1 HAs) between the vaccine strain and challenge strains is critical. For example, protection against Eurasian "avian-like" H1N1 swine viruses by MVA expressing A/California/7/09 HA was dependent on the similarity of antigenic site Sa .

  • Vaccine vector selection: Different vectors (MVA vs. conventional vaccinia) may elicit different immune response profiles:

    • Modified Vaccinia virus Ankara (MVA) is often preferred for safety in cross-protection studies

    • MVA vectors encoding H1 HA proteins can induce detectable HI antibody responses within 2 weeks of first immunization

  • Immunization protocol optimization:

    • Route of administration (systemic vs. mucosal)

    • Prime-boost strategies (homologous vs. heterologous)

    • Dose optimization for both priming and boosting

    • Interval between immunizations (typically 2-4 weeks)

  • Challenge strain selection: Include phylogenetically diverse strains to assess breadth of protection.

  • Protection assessment parameters:

    • Viral load reduction in respiratory tract (lungs, nasal turbinates)

    • Clinical symptom prevention or reduction

    • Antibody titer correlation with protection

    • T-cell response measurement

How should researchers interpret hemagglutination inhibition and virus microneutralization assay results in the context of cross-reactive immunity?

Interpreting hemagglutination inhibition (HI) and virus microneutralization (MN) assay results requires careful consideration of several factors:

  • Titer threshold determination:

    • For HI assays, titers ≥1:40 are typically considered protective in humans

    • In animal models, protective thresholds must be established experimentally

    • In one study, mice vaccinated with MVA-HA-CA/09 achieved geometric mean HI antibody titers of 1:293 (range, 1:80 to 1:640) two weeks after boost

  • Cross-reactivity patterns:

    • HI titers typically show greater strain specificity than MN titers

    • Reduced cross-reactive titers against heterologous strains are expected

    • The ratio of homologous:heterologous titers indicates antigenic relatedness

  • Correlation with protection:

    • Higher cross-reactive HI antibody levels correlate with protection against heterologous challenge

    • Protection depends on specific antigenic sites (e.g., site Sa of H1 HAs)

    • Some protection may occur despite low HI titers due to other immune mechanisms

  • Limitations to consider:

    • HI assays primarily detect antibodies targeting the receptor-binding site

    • MN assays capture broader neutralizing activity

    • Neither assay fully captures the contribution of cell-mediated immunity

A comprehensive interpretation should integrate results from both assays along with challenge study outcomes to establish correlates of protection.

What statistical approaches are recommended for analyzing protective efficacy in vaccinia-hemagglutinin vaccine studies?

Robust statistical approaches are essential for analyzing protective efficacy:

  • Sample size determination:

    • Power analysis to detect meaningful differences in protection

    • Typically 6-8 animals per group for mice studies, more for larger animals

    • Include appropriate controls: untreated, vector-only, inactivated influenza vaccine

  • Primary endpoint analysis:

    • For survival data: Kaplan-Meier survival analysis with log-rank test

    • For viral load: Mann-Whitney U test or ANOVA with appropriate post-hoc tests

    • For antibody titers: Geometric mean titers with 95% confidence intervals

    • For categorical protection outcomes: Fisher's exact test or chi-square test

  • Correlation analysis:

    • Spearman's rank correlation for relating antibody titers to protection

    • Linear regression for continuous variables

    • Logistic regression for binary protection outcomes

  • Multivariate approaches:

    • Principal component analysis for multidimensional immune response data

    • Multiple regression to identify independent predictors of protection

  • Reporting recommendations:

    • Include all animals in analyses (intention-to-treat)

    • Report both statistical and biological significance

    • Present individual data points alongside group means

    • Use appropriate data transformation (e.g., log-transformation for titers)

What are the emerging applications of vaccinia-expressed hemagglutinin beyond influenza vaccination?

Emerging applications of vaccinia-expressed hemagglutinin extend beyond traditional influenza vaccination:

  • Vector for studying immune response mechanisms:

    • As a tool for dissecting cytotoxic T-lymphocyte responses

    • For investigating the relationship between antibody specificity and protection

    • In comparative immunology studies across species

  • Platform for universal influenza vaccine strategies:

    • Expression of conserved HA stalk regions

    • Multi-valent constructs expressing HA from different strains

    • Co-expression with other conserved influenza antigens

  • Model for viral immunology research:

    • Understanding viral capture of cellular Ig-related genes

    • Studying the evolution of viral immune evasion strategies

    • Investigating the molecular basis of cross-protective immunity

  • Development of diagnostic reagents:

    • Production of standardized antigens for serological assays

    • Generation of reference materials for antibody calibration

    • Development of reporter systems for neutralizing antibody detection

These applications leverage the unique properties of vaccinia vectors, including their ability to accept large DNA inserts, stimulate both humoral and cellular immunity, and express complex glycoproteins with proper folding and post-translational modifications .

What research gaps exist in understanding the molecular mechanisms of vaccinia-expressed hemagglutinin in immune response induction?

Several critical research gaps remain in understanding molecular mechanisms:

  • Antigen presentation pathways:

    • The precise mechanisms by which vaccinia-expressed HA enters MHC class I and II presentation pathways

    • The role of autophagy in cross-presentation of vaccinia-expressed antigens

    • The impact of vector characteristics on presentation efficiency

  • Memory induction mechanisms:

    • Factors determining the quality and longevity of memory B and T cells

    • The influence of vaccinia vector components on memory formation

    • Optimal prime-boost strategies for durable immunity

  • Cross-reactive immunity determinants:

    • Molecular basis for cross-protection between heterologous strains

    • The role of minor epitopes versus immunodominant regions

    • Impact of glycosylation patterns on cross-reactivity

  • Innate immune interactions:

    • The interaction between vaccinia vector components and pattern recognition receptors

    • How these interactions shape the adaptive response to the expressed HA

    • The adjuvant effect of vaccinia-derived damage-associated molecular patterns

  • Host factors:

    • Genetic determinants of response quality and magnitude

    • Age-related factors affecting vaccine efficacy

    • Impact of prior exposure to influenza or vaccinia on response to recombinant vaccines

Addressing these gaps will enhance rational design of next-generation vaccines and immunotherapeutics based on vaccinia-expressed hemagglutinin.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.