Recombinant Vaccinia virus Late protein H7 (H7R)

Shipped with Ice Packs
In Stock

Description

Functional Role in Virion Morphogenesis

H7 is a late protein synthesized post-DNA replication and is indispensable for viral replication . Key functional insights include:

Membrane Biogenesis

  • Crescent formation: H7-deficient mutants fail to generate crescent membranes or immature virions (IVs). Instead, electron-dense inclusions containing unprocessed core proteins accumulate .

  • Defect severity: Deletion of H7R (ΔH7 mutant) blocks membrane biogenesis earlier than IPTG-inducible repression, preventing even short crescent precursors .

Proteolytic Processing

  • Core/membrane protein maturation: H7 repression inhibits cleavage of A17 (membrane) and A3 (core) proteins by the I7 protease, akin to rifampin treatment .

  • Pulse-chase assays: Viral late proteins are synthesized but remain unprocessed in the absence of H7 .

Table 2: Phenotypic Comparison of H7 Mutants

ParameterWT VACVIPTG-Inducible H7 RepressionΔH7 Deletion Mutant
Infectious virion yieldNormalUndetectable (-IPTG)Undetectable
Crescent membranesPresentAbsent (-IPTG)Absent
A17/A3 processingProcessedUncleaved (-IPTG)Uncleaved
D13 scaffold localizationNormalDisrupted (-IPTG)Disrupted
Data from

Genetic Studies

  • Conditional lethality: Recombinant VACV with H7 under a T7 promoter/lac operator system (vH7-HAi) requires IPTG for replication. Viral titers drop >100-fold without inducer .

  • Complementation: Transfection of H7R plasmids rescues ΔH7 mutant replication, confirming specificity .

Localization Defects

  • Viral factories: H7 repression causes core proteins (e.g., A10) to accumulate in dense cytoplasmic inclusions, while D13 scaffold proteins localize to separate ER-associated inclusions .

  • Membrane protein trafficking: ΔH7 mutants disrupt MV membrane protein localization (e.g., L1), but not A11 stability .

Phosphoinositide Binding and Mutational Analysis

H7’s interaction with phosphoinositides is critical for membrane biogenesis:

  • Binding specificity: Mutating basic residues (e.g., K85, R88) in the surface patch abolishes PI3P/PI4P binding and viral replication .

  • Structural basis: The C-terminal tail stabilizes lipid interactions, enhancing membrane targeting .

Table 3: Impact of H7 Mutations on Replication

MutationPI3P/PI4P BindingViral Titer (% WT)Phenotype
Wild-type H7Yes100%Normal morphogenesis
K85A/R88ANo<1%No crescents/IVs
ΔC-terminalReduced5%Delayed assembly
Data from

Discussion and Implications

H7 is a poxvirus-specific scaffold protein that coordinates membrane biogenesis and core maturation. Its phosphoinositide-binding activity likely facilitates membrane curvature and recruitment of viral envelope proteins. The inability of H7-deficient mutants to process core/membrane proteins underscores its role in coupling morphogenesis with proteolytic maturation. These findings position H7 as a potential target for antiviral strategies aimed at disrupting poxvirus assembly.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
H7R; Late protein H7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
H7R
Target Protein Sequence
MEMDKRIKSLAMTAFFGELNTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACADIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Uniprot No.

Target Background

Function

Contributes to the formation of crescents and immature virions (IV).

Protein Families
Chordopoxvirinae H7 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular weight and basic structure of the H7 protein?

The H7 protein of vaccinia virus is a 17-kDa protein that lacks discernible functional motifs or significant homology to non-poxvirus proteins. Structurally, it has been analyzed using X-ray crystallography, yielding models with excellent geometry and refinement statistics . The protein has a calculated pI of 6.74 and lacks putative transmembrane domains, signal peptides, or coiled-coil segments that can be identified from the amino acid sequence alone .

How conserved is the H7 protein across different poxviruses?

H7 demonstrates remarkable conservation across the poxvirus family. All chordopoxviruses that have been sequenced encode a homolog of the VACV H7R ORF, ranging from 138 to 152 amino acids in length. Multiple sequence alignments reveal that 96-100% of the H7 amino acid sequence is conserved among orthopoxviruses, while 37-44% conservation is maintained across other chordopoxvirus genera . This high degree of conservation strongly suggests an essential role in the viral life cycle.

When is H7 expressed during viral infection?

H7 is expressed as a late protein during vaccinia virus infection. Its synthesis is dependent on DNA replication and occurs during the late phase of the viral replication cycle. This classification is supported by several lines of evidence: (1) the presence of the nucleotide sequence TAAATG immediately preceding and overlapping the start of the H7R ORF, which is indicative of a late promoter; (2) the kinetics of H7 synthesis, which shows accumulation starting at around 9 hours post-infection; and (3) the complete inhibition of H7 expression when DNA replication is blocked with cytosine arabinoside (AraC) .

Why is H7 considered essential for vaccinia virus replication?

H7 is essential for vaccinia virus replication as demonstrated through inducible mutant studies. When the native H7R gene was replaced with one regulated by a bacteriophage T7 promoter and E. coli lac operator, virus replication became strictly dependent on the presence of IPTG (isopropyl-β-D-thiogalactopyranoside). In the absence of IPTG-induced H7 expression, infectious virus formation was completely inhibited, with only a slight increase in titer after 24 hours of infection . Complementation experiments further confirmed that this replication defect was specifically due to the repression of H7, as transfection with plasmids containing the H7R gene under its natural promoter partially rescued virus production in the absence of inducer .

What happens to viral morphogenesis in the absence of H7 protein?

In the absence of H7 protein, vaccinia virus morphogenesis is severely disrupted. Transmission electron microscopy of cells infected with H7-deficient virus reveals a complete absence of typical crescent membranes and immature virions. Instead, the cytoplasmic viral factories contain large, electron-dense inclusions, some of which have partially coated membrane segments at their surfaces . Additionally, separate, lower-density inclusions containing the D13 scaffold protein and endoplasmic reticulum membranes are observed. This phenotype indicates that H7 plays a critical role in the earliest stages of viral membrane formation and scaffolding .

How does H7 affect proteolytic processing during virus maturation?

H7 expression is essential for the proteolytic processing of both membrane and core proteins during vaccinia virus maturation. In the absence of H7, proteins like the A17 membrane protein and the A3 core protein fail to undergo normal proteolytic cleavage by the I7 protease . Pulse-chase experiments and Western blotting analyses demonstrate that while viral late protein synthesis remains unaffected in H7-deficient conditions, the pattern of proteins resembles that observed during rifampin treatment (which inhibits morphogenesis and prevents proteolytic maturation) . This suggests that H7 functions upstream of proteolytic processing events, likely by facilitating proper membrane formation required for subsequent maturation steps.

How can researchers generate recombinant vaccinia viruses with modified H7 expression?

Researchers can generate recombinant vaccinia viruses with modified H7 expression through a two-step homologous recombination approach. First, an epitope-tagged version of the H7 gene (e.g., with HA tag) is inserted adjacent to an inducible promoter (such as the T7 promoter with lac operator) in a transfer vector containing viral flanking sequences for recombination. After transfection into cells infected with a parental virus (that provides T7 RNA polymerase and lac repressor), recombinant viruses are selected using antibiotic resistance markers (e.g., guanine xanthine phosphoribosyl transferase allowing selection with mycophenolic acid) .

In the second step, the endogenous H7R gene is replaced with a reporter gene (such as GFP) through homologous recombination in the presence of inducer (IPTG), resulting in a final recombinant virus where H7 expression is strictly dependent on the inducer. The resulting virus can be clonally purified and verified through fluorescence microscopy and Western blotting .

What techniques are most effective for analyzing H7 protein expression and localization?

For analyzing H7 protein expression and localization, a multi-faceted approach is recommended:

  • Western blotting: When specific antibodies are not available, adding epitope tags (such as Flag or HA) to H7 enables detection via commercial antibodies. Typically, cells are infected with recombinant virus, lysed at various timepoints, and proteins separated by PAGE before transfer and immunoblotting .

  • Fluorescence microscopy: Utilizing either fluorescent protein fusions or immunofluorescence (with tagged constructs) allows visualization of H7 localization within infected cells. This technique revealed that H7 does not localize to specific cellular organelles .

  • Pulse-chase radiolabeling: Metabolic labeling with [35S]methionine-cysteine followed by chase periods provides insights into protein synthesis and processing kinetics .

  • Electron microscopy: Transmission electron microscopy combined with immunogold labeling offers ultrastructural details of H7's role in viral morphogenesis and can visualize the aberrant structures formed in its absence .

What is the recommended protocol for creating inducible H7 mutants for functional studies?

Creating inducible H7 mutants for functional studies requires a carefully designed protocol:

  • Vector preparation: Construct a plasmid containing the H7R gene with desired modifications (e.g., epitope tags) under the control of an inducible promoter system, such as the bacteriophage T7 promoter and E. coli lac operator .

  • Parental virus selection: Use a parent virus that already contains the E. coli lac repressor and T7 RNA polymerase genes (e.g., vT7LacOI) .

  • First recombination: Transfect cells infected with the parent virus with the plasmid transfer vector. Select recombinants using appropriate markers (e.g., mycophenolic acid resistance) .

  • Second recombination: Replace the endogenous H7R gene with a fluorescent marker (e.g., GFP) through homologous recombination while maintaining inducer (IPTG) in the medium .

  • Clonal purification: Isolate individual virus plaques identified by fluorescence and verify their purity through multiple rounds of plaque purification .

  • Verification: Confirm inducible phenotype through plaque assays in the presence and absence of inducer, one-step growth curves, and Western blotting to detect tagged H7 protein .

  • Complementation testing: Verify specificity by demonstrating rescue with plasmids expressing H7 under native promoters .

How do mutations in different regions of H7 affect its function in membrane biogenesis?

Structure-function analysis of H7 protein has revealed that specific domains are critical for its role in viral membrane biogenesis. While the search results don't provide detailed mutation analysis, the X-ray crystallographic studies mentioned suggest that H7 possesses a unique structure that likely contributes to its essential function . Future research should focus on systematic mutagenesis of conserved residues identified through multiple sequence alignments, followed by functional complementation assays to determine which regions are essential for membrane formation.

Researchers should consider:

  • Creating point mutations in highly conserved residues across poxvirus H7 homologs

  • Generating truncation mutants to identify minimal functional domains

  • Performing alanine scanning mutagenesis of surface-exposed residues identified in crystal structures

  • Assessing each mutant's ability to support crescent formation and virion morphogenesis

What is the relationship between H7 and other viral membrane assembly proteins (VMAPs)?

H7 is part of a group of proteins collectively known as viral membrane assembly proteins (VMAPs), which are essential for poxvirus membrane biogenesis . The functional relationships between these proteins remain an active area of research. Current models suggest that H7 works in concert with other VMAPs to facilitate the formation of viral crescents from host-derived membranes.

Research approaches to investigate these relationships include:

  • Co-immunoprecipitation studies to identify direct protein-protein interactions

  • Proximity labeling techniques (BioID, APEX) to map the H7 interactome during viral replication

  • Comparative phenotypic analysis of conditional mutants for different VMAPs

  • Super-resolution microscopy to visualize the spatiotemporal dynamics of VMAP recruitment during crescent formation

How might structural information about H7 inform antiviral drug development?

The X-ray crystallographic data available for H7 provides valuable structural information that could guide antiviral drug development . Since H7 is essential for viral replication and has no known homologs in host cells, it represents a potential target for poxvirus-specific inhibitors. Structure-based drug design approaches could exploit unique features of the H7 protein to develop compounds that disrupt its function.

Key considerations include:

  • Identifying potential binding pockets through computational analysis of crystal structures

  • Virtual screening of compound libraries against these pockets

  • Structure-activity relationship studies of promising lead compounds

  • Development of cell-based assays to evaluate candidate inhibitors' effects on viral morphogenesis

What are the main challenges in expressing and purifying H7 protein for structural studies?

While the search results mention X-ray crystallographic studies of H7 , they don't detail the specific challenges in expressing and purifying this protein. Based on the characteristics of H7 described in the literature, potential challenges likely include:

  • Solubility issues: As a protein involved in membrane biogenesis, H7 may have hydrophobic regions that affect solubility when expressed recombinantly.

  • Proper folding: Ensuring correct folding in heterologous expression systems may require optimization of expression conditions.

  • Protein stability: Maintaining stability during purification steps can be challenging for proteins involved in complex assembly processes.

Recommended solutions include:

  • Testing multiple expression systems (bacterial, insect, mammalian)

  • Utilizing solubility-enhancing fusion tags (MBP, SUMO)

  • Optimizing buffer conditions to enhance stability

  • Employing rapid purification protocols to minimize degradation

  • Considering co-expression with interacting partners to improve folding

How can researchers distinguish between direct and indirect effects when studying H7 function?

Distinguishing between direct and indirect effects when studying H7 function requires careful experimental design and controls. Since H7 is involved in early stages of viral morphogenesis, defects in its function can cascade into numerous downstream effects, making causal relationships difficult to establish.

Recommended approaches include:

  • Temporal studies: Utilizing tightly regulated inducible systems to observe the earliest consequences of H7 depletion or expression .

  • Complementation experiments: Testing whether wild-type H7 or specific mutants can rescue defects in conditional H7 mutants, as demonstrated in the literature .

  • Interaction studies: Identifying direct binding partners through techniques like co-immunoprecipitation, crosslinking mass spectrometry, or yeast two-hybrid screens.

  • Minimal systems approach: Attempting to reconstitute specific H7 functions in cell-free systems or simplified model membranes.

  • Rapid inactivation strategies: Employing techniques like the auxin-inducible degron system to achieve rapid protein depletion and observe immediate effects.

What are the best approaches for visualizing early membrane formation events involving H7?

Visualizing the early membrane formation events involving H7 presents significant technical challenges due to the small size and dynamic nature of these structures. Based on the research approaches described in the literature, optimal strategies include:

  • High-resolution electron microscopy: Transmission electron microscopy combined with immunogold labeling has successfully revealed the aberrant structures formed in the absence of H7 . Cryo-electron microscopy could provide additional structural details without chemical fixation artifacts.

  • Correlative light and electron microscopy (CLEM): This approach allows identification of specific fluorescently labeled components (such as tagged H7) followed by ultrastructural examination of the same structures.

  • Super-resolution fluorescence microscopy: Techniques like STORM, PALM, or STED microscopy can achieve resolution beyond the diffraction limit, potentially revealing details of early membrane formation events.

  • Live-cell imaging: Employing fluorescent protein fusions with H7 and other VMAPs in combination with lattice light-sheet microscopy could capture the dynamics of early membrane formation in living cells.

  • Focused ion beam scanning electron microscopy (FIB-SEM): This technique allows for 3D visualization of viral factories at different stages of morphogenesis, potentially revealing spatial relationships between H7-containing structures and cellular membranes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.