Recombinant Vaccinia virus Late protein H7 (MVA097R, ACAM3000_MVA_097)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MVA097R; ACAM3000_MVA_097; H7R; Late protein H7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Vaccinia virus (strain Ankara) (VACV)
Target Names
MVA097R
Target Protein Sequence
MEMDKRMKSLAMTAFFGELNTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Uniprot No.

Target Background

Function
Contributes to the formation of crescents and immature virions (IV).
Protein Families
Chordopoxvirinae H7 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the primary function of Vaccinia virus Late protein H7?

H7 protein contributes fundamentally to the formation of crescent membranes and immature virions during poxvirus morphogenesis. These crescent membranes represent the first discernible viral structures in the morphogenesis process, consisting of a lipoprotein membrane with an outer lattice scaffold that provides uniform curvature . The H7 protein appears to be critical in the very early stages of viral membrane formation, as its absence prevents the formation of typical crescents and immature virions, leading to a block in the viral morphogenesis pathway . Experimental evidence supports its essential role in replication, as conditional lethal mutants lacking H7 expression fail to produce infectious virus particles .

How is the H7 protein regulated during viral infection?

H7 protein synthesis occurs late during vaccinia virus infection and is dependent on viral DNA replication. This timing has been verified through experiments using cytosine arabinoside (AraC), which blocks DNA replication and subsequently prevents H7 synthesis even at 24 hours post-infection . The H7R open reading frame contains the nucleotide sequence TAAATG immediately preceding and overlapping its start, which is indicative of a late promoter . Western blotting experiments show that H7 accumulation follows a similar time course to other well-characterized late proteins such as A3, with both proteins becoming detectable around 9 hours post-infection and increasing thereafter .

What is the conservation status of H7 across poxvirus species?

The H7 protein exhibits remarkable evolutionary conservation across the poxvirus family. All chordopoxviruses that have been sequenced encode a homolog of the Vaccinia virus H7R ORF, with lengths varying from 138 to 152 amino acids . Multiple sequence alignments reveal extremely high conservation rates among orthopoxviruses (96-100% amino acid conservation) and significant conservation (37-44%) even among more distantly related chordopoxvirus genera . This high degree of conservation strongly suggests an indispensable role in the viral life cycle, which has been experimentally confirmed through the inability to generate viable H7 deletion mutants .

What is the subcellular localization pattern of H7 during infection?

Unlike many viral late proteins, H7 is not incorporated into mature virions in appreciable amounts. Confocal microscopy studies using tagged H7 proteins reveal that while H7 is initially detected in viral factories (the sites of late protein synthesis), it becomes more dispersed throughout the cell as infection progresses . By 12 and 24 hours post-infection, H7 shows a diffuse distribution pattern distinct from virion-associated proteins like L1, which remain concentrated in factories and punctate structures representing virus particles . Biochemical fractionation experiments support this observation, as H7 is detected in cell extracts but not in purified virions following sucrose density gradient centrifugation .

What experimental approaches can determine the protein-protein interactions of H7 during viral morphogenesis?

To effectively map H7 interactions during morphogenesis, researchers should employ complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): Using H7 with tandem affinity tags similar to the 3×Flag-streptavidin-binding peptide construct described in the literature , perform pulldowns under native conditions at different time points during infection. Cross-linking prior to lysis can capture transient interactions. Sequential purification steps followed by mass spectrometry analysis will identify specific binding partners.

  • Proximity-dependent biotin labeling: Fusion of H7 with enzymes like BioID or TurboID enables labeling of proteins within nanometer proximity of H7 in living cells, potentially capturing interactions occurring during dynamic morphogenesis stages.

  • Co-immunoprecipitation validation: Validate key interactions identified through the above high-throughput methods using targeted co-IP experiments with candidate partners, focusing particularly on proteins involved in membrane formation such as A11, which functions at a similar stage despite lacking demonstrated direct interaction .

  • Split reporter protein complementation assays: Use BiFC (Bimolecular Fluorescence Complementation) to visualize H7 interactions within the cellular context, providing spatial information about where these interactions occur during the viral life cycle.

These approaches should be performed in both wild-type infections and in conditional mutant backgrounds (e.g., A11 repression) to distinguish direct from indirect interactions.

How can researchers differentiate between the molecular functions of H7 and other proteins involved in viral membrane formation?

Distinguishing the specific role of H7 from other proteins involved in viral membrane formation requires systematic comparative analysis:

  • Temporal role delineation: Using inducible systems like the IPTG-dependent H7 expression system , perform time-of-addition studies to determine precisely when H7 function is required. Compare with similar experiments for A11, F10, G5, and H5, all implicated in membrane formation .

  • Protein domain analysis and mutagenesis: Despite lacking discernible functional motifs , systematic alanine scanning or deletion mutagenesis can identify regions critical for H7 function. Compare the resulting phenotypes with those from similar mutations in other membrane formation proteins.

  • Interactome mapping: Cross-reference protein interaction networks of H7 with those of A11, A14, A17, and other membrane-associated proteins to identify unique vs. shared interaction partners.

  • Microscopy phenotype profiling: Quantitative analysis of the morphological differences in electron microscopy phenotypes between H7, A11, F10, G5, and H5 mutants can reveal subtle distinctions in their roles. The formation of characteristic dense inclusions versus membrane vesicles or tubules provides key differentiation points .

  • Biochemical membrane analysis: Comparison of lipid composition and protein content of membrane fragments that form when each protein is repressed can help determine their specific contributions to membrane biogenesis.

The combined data from these approaches will help construct a functional hierarchy and interdependence map of proteins involved in viral membrane formation.

What molecular mechanisms explain how H7 contributes to viral membrane formation despite lacking transmembrane domains or membrane association signals?

This apparent paradox can be investigated through these research approaches:

  • Indirect membrane interaction analysis: Test for post-translational modifications (lipidation, phosphorylation) that might temporarily associate H7 with membranes using mass spectrometry and biochemical fractionation under different detergent conditions.

  • Bridging protein identification: Identify proteins that interact with both H7 and membranes through crosslinking followed by immunoprecipitation and mass spectrometry. Prime candidates include proteins that:

    • Bind to H7

    • Associate with membranes or membrane proteins

    • Show similar morphogenesis defects when depleted

  • Enzymatic activity assessment: Even without obvious catalytic motifs, H7 may possess cryptic enzymatic functions that affect membrane formation. Test for lipid modification activities, membrane fusion/fission promotion, or scaffold assembly properties using in vitro reconstitution assays.

  • Membrane recruitment dynamics: Using live cell imaging of fluorescently tagged H7 and membrane markers, track transient membrane associations during specific stages of viral replication. Super-resolution microscopy can detect brief co-localization events that conventional microscopy might miss.

The relationship between H7 and A11 is particularly significant here, as they function at similar stages despite lacking direct interaction . They may represent components of parallel pathways that converge on the same membrane formation process.

What are the optimal experimental systems for studying H7 function in different research contexts?

Research GoalRecommended SystemAdvantagesConsiderations
Basic H7 localizationvFS-H7 recombinant virus Maintains natural promoter expression kinetics; Tags enable detectionPotential tag interference with function requires validation
Conditional expressionvH7-HAi IPTG-inducible system Tight regulation; Allows analysis of complete H7 depletionLeaky expression assessment needed; IPTG concentration optimization required
Structure-function analysisComplementation assay with mutant H7 constructs Tests specific domains' importance while virus provides all other proteinsTransfection efficiency varies; Multiple rounds of infection needed for optimal results
Biochemical interactionsTandem affinity purification with 3×Flag-SBP tag Sequential purification reduces background; Compatible with MS analysisRequires optimization of extraction conditions for transient interactions
Visual phenotype characterizationElectron microscopy of sections from conditionally expressing cells Direct visualization of morphogenesis defectsLabor-intensive; Requires correlation with biochemical and genetic data

For most comprehensive analysis, researchers should combine conditional expression systems (to control timing and levels of H7) with biochemical and microscopy approaches to correlate molecular interactions with morphological phenotypes.

How can researchers effectively analyze the proteolytic processing defects observed in H7-deficient infections?

The inhibition of proteolytic processing of viral membrane and core proteins observed in H7-deficient conditions can be systematically investigated through:

  • Pulse-chase experimental design: Optimal protocols include:

    • Infection of BS-C-1 cells with inducible H7 virus (vH7-HAi) with/without IPTG

    • Metabolic labeling with [35S]methionine-cysteine for 15 minutes at specific time points post-infection

    • Chase periods of varying lengths (0, 30, 60, 120 minutes)

    • Immunoprecipitation of specific target proteins (A17, A3, others) followed by SDS-PAGE

    • Quantification of precursor:processed form ratios

  • Western blot time-course analysis: For detecting subtle processing defects:

    • Sample collection at 2-hour intervals from 0-24 hours post-infection

    • Parallel blots probing for multiple proteins (membrane proteins A17, A14; core proteins A3, A10, L4)

    • Inclusion of positive controls for processing inhibition (rifampin treatment )

    • Quantitative densitometry to measure precursor and processed forms

  • I7 protease activity assays: To determine if H7 affects protease function directly:

    • In vitro cleavage assays using recombinant I7 and substrate peptides

    • Comparison of I7 localization in normal versus H7-deficient conditions

    • Assessment of I7-substrate co-localization by immunofluorescence

  • Correlative light and electron microscopy: Connect processing defects to structural abnormalities:

    • Immuno-EM using antibodies against both precursor and processed forms

    • Quantification of protein processing status in different morphological structures

This multi-faceted approach allows researchers to determine whether H7 affects protease recruitment, substrate accessibility, or the creation of an environment conducive to proteolytic processing.

What controls and validation steps are essential when working with inducible H7 mutant systems?

When utilizing inducible systems such as the IPTG-regulated H7 expression virus (vH7-HAi) , the following controls and validation steps are critical:

  • Dose-response calibration:

    • Establish a comprehensive IPTG dose-response curve (0, 10, 25, 50, 100, 200, 500 μM)

    • Measure both H7 protein levels and virus yield at each concentration

    • Identify minimum IPTG concentration for full rescue and partial rescue conditions

  • Growth kinetics validation:

    • Perform one-step growth curves with sampling at 4-hour intervals

    • Compare growth of parental virus (vT7LacOI) to vH7-HAi with and without inducer

    • Document any growth delay even in the presence of optimal IPTG concentration

  • Genetic complementation controls:

    • Transfect plasmids expressing wild-type H7 under its natural promoter

    • Include irrelevant protein expression (e.g., HcRed) as negative control

    • Quantify rescue efficiency with different complementing constructs

  • System leakiness assessment:

    • Use highly sensitive detection methods (e.g., quantitative PCR, digital droplet PCR) to measure any transcription occurring without inducer

    • Western blotting with long exposure times to detect minimal H7 expression

    • Correlate any detected leakiness with partial phenotypic rescue

  • Reversibility testing:

    • Establish inducer removal protocols at different infection stages

    • Document the kinetics of phenotype emergence after inducer withdrawal

    • Determine if H7 is required continuously or only at specific stages

These controls ensure that observations attributed to H7 deficiency are specifically due to the protein's absence rather than experimental artifacts or secondary effects of the inducible system.

How might high-resolution structural studies of H7 advance our understanding of its function?

Despite extensive functional characterization, the three-dimensional structure of H7 remains unknown. Structural determination would significantly enhance our understanding by:

  • Structure prediction and analysis approaches:

    • Use of AlphaFold2 or RoseTTAFold to generate preliminary structural models

    • Molecular dynamics simulations to identify potential binding interfaces

    • Comparative analysis with structures of proteins having similar functions despite lack of sequence homology

  • Experimental structure determination strategies:

    • X-ray crystallography with purified recombinant H7, potentially requiring chaperones or binding partners for stability

    • Cryo-electron microscopy of H7 complexes isolated from infected cells

    • NMR spectroscopy for dynamic regions identification and potential membrane interaction surfaces

  • Structure-guided functional studies:

    • Targeted mutagenesis of residues in predicted functional domains

    • Design of small-molecule inhibitors of H7-partner protein interactions

    • Engineering of H7 variants with enhanced or altered functions

Structural insights would be particularly valuable for understanding how H7 contributes to membrane formation despite lacking obvious membrane-association domains, potentially revealing novel protein-protein or protein-lipid interaction mechanisms in viral morphogenesis.

What comparative analysis between H7 and A11 would provide insight into their potentially complementary roles?

The H7 and A11 proteins show remarkably similar phenotypes when repressed despite lacking sequence homology or demonstrated direct interaction . Systematic comparative analysis would include:

  • Temporal requirement mapping:

    • Create dual inducible systems allowing independent control of H7 and A11 expression

    • Determine if sequential or simultaneous expression is required

    • Test whether overexpression of one can partially compensate for deficiency in the other

  • Interactome overlap analysis:

    • Perform parallel immunoprecipitation-mass spectrometry studies of both proteins

    • Identify common versus unique interaction partners

    • Map the interaction networks to determine if they converge on the same downstream effectors

  • Ultrastructural phenotype comparison:

    • Quantitative electron microscopy comparing single and double mutant phenotypes

    • 3D electron tomography to fully characterize the dense inclusions and membrane segments

    • Immuno-EM to determine the precise localization patterns of both proteins

  • Biochemical activity screening:

    • Test both proteins for similar enzymatic activities (lipid modification, etc.)

    • Assess if they form hetero-oligomeric complexes with other viral or cellular proteins

    • Determine if they modify the same target substrates through different mechanisms

This comparative approach would help establish whether H7 and A11 represent redundant systems, sequential steps in the same pathway, or components of parallel pathways that converge on the same morphogenesis process.

What strategies can resolve common technical challenges when studying the H7 protein?

ChallengePotential SolutionImplementation Notes
Low H7 antibody sensitivityGenerate recombinant H7 with dual tags (3×Flag-SBP) Maintain natural promoter; validate function by complementation
Difficulty distinguishing H7 phenotype from other mutantsQuantitative EM scoring systemScore >100 cell sections for: dense inclusions, membrane segments, D13 localization
Incomplete IPTG-inducible system repressionCombine with siRNA knockdownTarget remaining H7 mRNA; validate specificity with rescue constructs
Poor H7 solubility in biochemical assaysTest multiple extraction buffersTry ionic strength series (150-500mM NaCl) with various detergents (NP-40, DDM, CHAPS)
Inconsistent complementation resultsOptimize transfection timingTransfect 2-4 hours post-infection; use electroporation for higher efficiency
Difficulty detecting transient H7 interactionsIn situ crosslinkingUse membrane-permeable crosslinkers (DSP, formaldehyde) prior to cell lysis
Variability in processing defect detectionStandardize infection synchronicityUse cold-binding protocol followed by temperature shift for synchronized entry

When faced with persistent technical challenges, researchers should consider developing new tools such as split-reporter systems, degron-based conditional expression, or CRISPR interference approaches that may provide more precise control over H7 expression than existing systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.