Recombinant Vaccinia virus Late protein H7 (VACWR105)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VACWR105; H7R; Late protein H7; Protein H8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR105
Target Protein Sequence
MEMDKRMKSLAMTAFFGELSTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Uniprot No.

Target Background

Function
Contributes to the formation of crescents and immature virions (IV). Interacts with phosphatidylinositol-3-phosphate (PI3P) and phosphatidylinositol-4-phosphate (PI4P) lipids to facilitate virion membrane formation.
Gene References Into Functions
  1. Studies indicate that H7's phosphoinositide binding is crucial for poxvirus membrane biogenesis. PMID: 25473060
  2. In the absence of H7, viral late proteins are produced, but membrane and core proteins lack I7 protease processing. PMID: 19553304
Database Links

KEGG: vg:3707561

Protein Families
Chordopoxvirinae H7 family
Subcellular Location
Membrane; Single-pass membrane protein. Host cytoplasm. Note=Probably transitorily part of the membrane of cresents during immature virions formation. Not incorporated into virions. Probably synthesized, but not retained in viral factories.

Q&A

What is the molecular characterization of the H7 protein?

H7 is a 17-kDa protein encoded by the H7R open reading frame in the vaccinia virus genome. The protein is highly conserved among orthopoxviruses (96-100% amino acid sequence identity) and shows 37-44% conservation among other chordopoxvirus genera . The protein has a calculated pI of 6.74 and lacks transmembrane domains, signal peptides, or distinctive structural features that would suggest its function . The gene is preceded by the nucleotide sequence TAAATG, characteristic of a late promoter, confirming its expression timing during viral infection .

Methodological approach: To study H7, researchers have created recombinant viruses with epitope and affinity tags (such as 3×Flag and streptavidin-binding peptide) fused to the H7 protein. This approach allows detection using commercially available antibodies and facilitates protein interaction studies through pull-down assays .

When is H7 expressed during vaccinia virus infection?

H7 is synthesized late during vaccinia virus infection, with expression dependent on viral DNA replication. Experimental evidence shows that H7 protein accumulation follows the same kinetics as other well-characterized late proteins such as A3 . The protein becomes detectable at approximately 9 hours post-infection and increases over time . When DNA replication is blocked with cytosine arabinoside (AraC), H7 expression is completely inhibited, confirming its classification as a late protein .

Methodological approach: To determine expression timing, researchers infected cells with recombinant virus containing tagged H7, collected samples at various time points, and performed Western blotting with antibodies against the tag. Parallel detection of known early and late proteins provided temporal reference points .

Where is H7 localized within infected cells?

Unlike many viral proteins that localize to specific cellular compartments or are incorporated into virions, H7 shows a more diffuse distribution. While initially detected in viral factories (the sites of viral DNA replication and protein synthesis), H7 becomes increasingly dispersed throughout the cytoplasm as infection progresses . Importantly, biochemical fractionation and Western blotting demonstrate that H7 is not packaged into mature virions, distinguishing it from structural proteins like A3 .

Methodological approach: Localization studies typically employ confocal microscopy of cells infected with recombinant viruses expressing tagged H7. DNA staining (e.g., with DAPI) identifies viral factories, while immunofluorescence with antibodies against viral markers (like membrane protein L1) provides reference points for viral structures .

How can inducible systems be designed to study essential viral proteins like H7?

Studying essential viral proteins presents methodological challenges since their deletion prevents virus replication. For H7 research, scientists developed an inducible system using the bacteriophage T7 promoter and Escherichia coli lac operator . This approach involves a two-step process:

  • Construction of a recombinant vaccinia virus (vT7LacOI) containing both E. coli lac repressor and phage T7 RNA polymerase in the thymidine kinase locus

  • Replacement of the native H7R gene with one regulated by the T7 promoter and lac operator

In this system, the lac repressor is constitutively expressed, while the T7 RNA polymerase is inducible. Addition of isopropyl-β-D-thiogalactopyranoside (IPTG) induces expression of T7 RNA polymerase, which then drives H7 expression .

Data table: Construction of inducible H7 expression system

ComponentFunctionLocation
E. coli lac repressorBlocks transcription from lac operatorJ2R (thymidine kinase) locus
T7 RNA polymeraseDrives transcription from T7 promoterJ2R locus, regulated by lac operator
H7-HA geneProduces epitope-tagged H7 proteinA56R (HA) locus, under T7 promoter control
GFP markerVisualizes infected cellsReplaces endogenous H7R

This system allows precise control over H7 expression, with virus replication strictly dependent on IPTG induction. Plaque formation occurs only in the presence of inducer, and virus yield correlates directly with IPTG concentration .

What is the role of H7 in vaccinia virus morphogenesis?

H7 plays a critical role in the early stages of vaccinia virus morphogenesis, specifically in the formation of crescent membranes and immature virions (IVs). In the absence of H7, neither typical crescents nor IVs form, indicating a block at a very early stage of morphogenesis . Electron microscopy of H7-deficient infections reveals abnormal structures:

  • Large, electron-dense inclusions containing core proteins

  • Separate, lower-density inclusions containing the D13 scaffold protein

  • Endoplasmic reticulum membranes associated with these inclusions

  • Occasional membrane segments partially coated with D13 protein spicules at the surface of dense inclusions

Methodological approach: Researchers investigate H7's role in morphogenesis through multiple complementary techniques:

  • Transmission electron microscopy of thin cell sections to visualize viral structures

  • Immunogold labeling to identify specific viral proteins within structures

  • Western blotting to monitor processing of viral proteins

  • Metabolic labeling with radioactive amino acids to track protein synthesis and processing

How does H7 deficiency affect viral protein processing?

When H7 expression is repressed, viral late protein synthesis proceeds normally, but proteolytic processing of certain viral proteins is inhibited . This processing defect affects both membrane proteins (such as A17) and core proteins (such as A3) . Under normal conditions, these proteins undergo proteolytic maturation by the viral I7 protease during morphogenesis. In pulse-chase experiments, cells infected with H7-deficient virus show protein profiles similar to those seen with the morphogenesis inhibitor rifampin .

Additionally, some viral membrane proteins, including A28, show abnormal glycosylation when H7 is repressed . This glycosylation, confirmed by peptide:N-glycosidase F treatment, suggests aberrant trafficking of viral membrane proteins in the absence of H7 .

Methodological approach: Protein processing analysis employs:

  • Pulse-chase labeling with [35S]methionine-cysteine followed by autoradiography

  • Western blotting with antibodies specific to precursor and processed forms of viral proteins

  • Enzymatic treatments (e.g., glycosidases) to characterize post-translational modifications

How does H7 compare functionally to other morphogenesis proteins?

Among vaccinia virus morphogenesis proteins, H7 appears most similar in function to A11, despite lacking sequence homology . Both proteins:

  • Are expressed late in infection

  • Are not incorporated into mature virions

  • Are essential for crescent and IV formation

  • When repressed, lead to similar phenotypes including:

    • Inhibition of A17 and core protein processing

    • Formation of electron-dense inclusions containing core proteins

    • Formation of intermediate-density inclusions containing D13 and ER membranes

    • Reduced levels of the L1 membrane protein

Methodological approach: Comparative functional analysis involves:

  • Constructing parallel inducible mutants for different genes

  • Characterizing morphological defects through electron microscopy

  • Analyzing protein processing patterns in different mutants

  • Performing co-immunoprecipitation experiments to test protein interactions

What strategies can be used to study protein-protein interactions involving H7?

Studying protein-protein interactions for H7 presents challenges due to the lack of specific antibodies and its transient role in morphogenesis. Several complementary approaches are recommended:

  • Epitope tagging: Adding tags such as FLAG, HA, or streptavidin-binding peptide allows purification and detection of H7 and potential binding partners . The tagged protein should be validated to ensure functionality by complementation testing.

  • Crosslinking assays: Chemical crosslinkers can capture transient interactions before cell lysis. Time-course experiments with various crosslinkers can help identify the optimal conditions.

  • Proximity labeling: Techniques like BioID or APEX, where H7 is fused to a promiscuous biotin ligase, allow identification of proteins in close proximity in living cells.

  • Immunoprecipitation with mass spectrometry: Using antibodies against the epitope tag to pull down H7 complexes, followed by mass spectrometry to identify interacting partners .

Methodological consideration: When designing interaction studies, include appropriate controls such as non-specific tags and consider that H7 interactions may be temporally regulated during infection.

How can complementation assays be optimized to validate H7 mutants?

Complementation assays are essential for confirming that phenotypes observed in H7-deficient viruses are specifically due to the absence of H7 rather than secondary effects. Research shows that transfection of plasmids containing the H7R gene under its natural promoter can partially rescue the replication defect of H7-deficient viruses .

To optimize complementation assays:

  • Promoter selection: Using the natural H7R promoter ensures proper timing and level of expression . Alternative promoters (constitutive or inducible) can be tested to determine optimal expression.

  • Delivery method: Transfection efficiency significantly impacts complementation success. Compare lipid-based transfection, electroporation, and viral vectors to determine optimal delivery.

  • Timing: Since H7 is a late protein, transfection should precede infection to ensure plasmid uptake before cytopathic effects develop.

  • Quantification: Measure complementation through multiple metrics including:

    • Virus yield (plaque assays)

    • Protein processing (Western blotting)

    • Morphogenesis (electron microscopy)

Data from complementation experiments: In published studies, complementation with wild-type H7 increased virus yield approximately 10-fold compared to controls using irrelevant proteins (HcRed) .

What imaging techniques are most effective for studying H7's role in morphogenesis?

Understanding H7's role in morphogenesis requires sophisticated imaging approaches:

  • Transmission electron microscopy (TEM): The gold standard for visualizing viral morphogenesis, TEM reveals ultrastructural defects in H7-deficient infections, including abnormal inclusions and incomplete membrane formation .

  • Immunoelectron microscopy: Adding gold-labeled antibodies to TEM allows precise localization of specific viral proteins within structures, critical for understanding how H7 deficiency affects the distribution of other morphogenesis factors .

  • Correlative light and electron microscopy (CLEM): Combines fluorescence microscopy with EM to correlate protein localization with ultrastructural features.

  • Live-cell confocal microscopy: Using fluorescently tagged proteins allows real-time monitoring of H7 dynamics during infection, though resolution limitations must be considered .

  • Super-resolution microscopy: Techniques like STORM or PALM overcome the diffraction limit of conventional microscopy, potentially revealing H7 interactions not visible by standard confocal microscopy.

Methodological considerations: When studying proteins involved in membrane formation, sample preparation is critical. Different fixation methods (chemical vs. cryofixation) may reveal different aspects of the morphogenesis process.

How can researchers distinguish direct versus indirect effects of H7 deficiency?

Distinguishing direct from indirect effects of H7 deficiency presents a significant challenge. Several analytical approaches can help:

  • Temporal analysis: Determine the earliest detectable defect following H7 repression through time-course experiments. Earlier defects are more likely to be direct consequences of H7 absence .

  • Partial complementation: Titrate H7 expression using varying IPTG concentrations to establish a dose-response relationship. Defects that respond proportionally to H7 levels are likely more directly related to H7 function .

  • Separation of phenotypes: Some viral mutants exhibit multiple defects. Careful analysis may reveal whether these are separable phenotypes or a cascade from a single primary defect.

  • Comparative analysis with other mutants: Compare H7-deficient phenotypes with those of other morphogenesis mutants (e.g., A11, F10, G5, H5). Similarities and differences can help position H7 in the morphogenesis pathway .

  • Suppressors and enhancers: Identify second-site mutations that suppress or enhance H7 deficiency phenotypes to reveal functional relationships.

Analytical consideration: When H7-deficient viruses show membrane formation defects, it's important to determine whether H7 directly participates in membrane biogenesis or regulates other proteins involved in this process.

What statistical approaches are appropriate for quantifying morphological defects in H7-deficient infections?

Quantitative analysis of morphological defects requires rigorous statistical approaches:

  • Random sampling: When counting viral structures by electron microscopy, use systematic random sampling to avoid bias toward areas with obvious phenotypes.

  • Blinded analysis: Have observers count structures without knowing the experimental conditions to prevent confirmation bias.

  • Adequate sample size: For each condition, analyze multiple cell sections (typically >50) from at least three independent experiments to ensure reproducibility.

  • Multiple metrics: Quantify various aspects of morphogenesis:

    • Number of crescent membranes per factory area

    • Proportion of normal versus abnormal crescents

    • Size distribution of electron-dense inclusions

    • Co-localization coefficients for viral proteins

  • Appropriate statistical tests: Use non-parametric tests (Mann-Whitney U) when data don't follow normal distributions, as is common with morphological features.

Presentation recommendation: Present morphological data as both representative images and quantitative graphs showing the distribution of phenotypes across multiple experiments.

How can researchers reconcile contradictory findings in H7 research?

Research on complex viral proteins like H7 sometimes produces apparently contradictory results. Strategies to reconcile such findings include:

  • Methodological differences analysis: Compare experimental conditions between studies, including:

    • Cell types used (different cells may provide different host factors)

    • Viral strains (genetic differences between laboratory strains)

    • Detection methods (antibody specificity, fixation protocols)

    • Temporal factors (timing of observations)

  • Threshold effects: Some phenotypes may appear contradictory because they manifest only when protein levels fall below certain thresholds.

  • Multifunctional proteins: H7 may have multiple functions, and different experimental approaches may reveal different aspects of its activity.

  • Indirect versus direct effects: Apparent contradictions may reflect a mixture of primary and secondary consequences of H7 deficiency.

  • Replication with standardized protocols: Direct side-by-side comparisons using identical protocols can resolve whether differences reflect biological reality or methodological variation.

Analytical recommendation: When faced with contradictory findings, consider whether H7 functions in a complex with other viral proteins, where context-dependent interactions might explain variable results.

What structural biology approaches could reveal H7's molecular function?

Despite its importance, the molecular mechanism of H7 remains unclear. Several structural biology approaches could provide insights:

  • X-ray crystallography: Determining the crystal structure of purified H7 would reveal structural motifs not apparent from sequence analysis and potentially suggest functional mechanisms .

  • Cryo-electron microscopy: For proteins resistant to crystallization, cryo-EM can provide structural information, particularly for H7 in complex with interaction partners.

  • NMR spectroscopy: For smaller domains of H7, NMR could reveal dynamic aspects of protein function and identify potential binding interfaces.

  • Hydrogen-deuterium exchange mass spectrometry: This technique can map conformational changes and protein-protein interaction surfaces without requiring crystallization.

  • In silico structural prediction: With advances in AI-based structure prediction (e.g., AlphaFold), computational modeling could provide testable hypotheses about H7 function.

Methodological consideration: For optimal structural studies, expression and purification systems must be optimized. Bacterial expression systems often fail for viral proteins, making insect cell or mammalian expression systems preferable alternatives.

How might CRISPR-based approaches advance H7 research?

CRISPR/Cas technologies offer new possibilities for studying essential viral proteins like H7:

  • Genome-wide screens: CRISPR knockout or interference screens could identify host factors that modulate H7 function or compensate for its deficiency.

  • Direct viral genome editing: CRISPR systems can introduce precise mutations into the H7R gene to create point mutants rather than complete knockouts.

  • CRISPRi for temporal control: CRISPR interference systems provide an alternative to traditional inducible systems, potentially allowing more precise temporal control of H7 expression.

  • CRISPR activation systems: These could be used to upregulate host factors that might compensate for H7 deficiency, potentially revealing functional pathways.

  • Base editing and prime editing: These CRISPR derivatives allow introduction of specific amino acid changes without double-strand breaks, enabling fine structure-function analysis.

Methodological consideration: When applying CRISPR to poxvirus research, delivery timing is critical since the cytoplasmic replication cycle may limit accessibility to CRISPR components delivered after infection.

What systems biology approaches could elucidate H7's position in the viral morphogenesis network?

Understanding H7's position in the complex network of vaccinia morphogenesis requires integrative approaches:

  • Global proteomic analysis: Quantitative proteomics comparing wild-type and H7-deficient infections could reveal broader changes in the viral and cellular proteome.

  • Interaction network mapping: Techniques like BioID followed by mass spectrometry could map the protein interaction neighborhood of H7 during different stages of infection.

  • Phosphoproteomics: Since many morphogenesis steps are regulated by phosphorylation, comparing phosphorylation patterns between wild-type and H7-deficient infections could reveal regulatory mechanisms.

  • Transcriptomics: While H7 acts post-transcriptionally, RNA-seq analysis might reveal feedback effects on host or viral gene expression.

  • Computational modeling: Integrating multiple data types into mathematical models could generate testable predictions about H7's functional relationships.

Analytical recommendation: Data from systems approaches should be integrated with focused mechanistic studies, as large-scale analyses often generate hypotheses requiring targeted validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.