Recombinant Vaccinia virus Late protein H7 (TH8R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TH8R; Late protein H7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Vaccinia virus (strain Tian Tan) (VACV)
Target Names
TH8R
Target Protein Sequence
MEMDKRMKSLAMTAFFGELNTLDIMALIMSIFKRHPNNTIFSVDKDGQFIIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC
Uniprot No.

Target Background

Function
Contributes to the formation of crescents and immature virions (IV).
Protein Families
Chordopoxvirinae H7 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structural composition of H7 protein in vaccinia virus?

H7 is a 17 kDa protein conserved in all vertebrate poxviruses, consisting of seven α-helical domains, three β-strands, and a 29 amino acid long C-terminal flexible tail . The seventh α-helical domain contains a putative PX domain involved in phosphoinositide binding . Despite its conservation, H7 lacks discernible functional motifs or non-poxvirus homologs that would suggest its function . X-ray crystallography has revealed its tertiary structure, which provides insights into potential interactions with viral and host factors .

When and how is H7 expressed during the viral life cycle?

H7 synthesis is dependent on DNA replication and occurs late during vaccinia virus infection . The expression is regulated by a characteristic late promoter with the nucleotide sequence TAAATG preceding and overlapping the start of the H7R ORF . Using pulse-chase experiments with radioactive amino acids and Western blotting, research has confirmed that H7 expression follows the kinetics typical of late viral proteins, appearing approximately 9 hours post-infection and increasing over time .

Why is H7 considered essential for vaccinia virus replication?

Studies using conditional lethal mutants demonstrate that H7 is absolutely required for the production of infectious virus . When H7 expression is repressed in inducible systems, viral late protein synthesis appears normal, but proteolytic processing of membrane and core proteins is inhibited . Complementation experiments confirm that the replication defect is specifically due to the absence of H7 . Transmission electron microscopy reveals that without H7, neither typical crescents nor immature virions are formed, indicating a critical early block in morphogenesis .

How can researchers create conditional mutants to study H7 function?

To study essential genes like H7, researchers can construct inducible systems where gene expression is controlled by exogenous factors. A well-documented approach involves:

  • Replacing the native H7R gene with one regulated by a bacteriophage T7 promoter and E. coli lac operator

  • Using a parental virus (e.g., vT7LacOI) that contains both the E. coli lac repressor and phage T7 RNA polymerase

  • Constructing the recombinant in two steps:

    • First, inserting an epitope-tagged H7 gene adjacent to the T7 promoter and lac operator

    • Then replacing the endogenous H7R gene with a marker gene (e.g., GFP)

  • Controlling H7 expression using isopropyl-β-D-thiogalactopyranoside (IPTG)

This approach allows for stringent control of H7 expression, with virus replication dependent on the presence of the inducer .

What techniques are most effective for analyzing H7's role in morphogenesis?

Multiple complementary techniques provide comprehensive insights into H7 function:

  • Transmission electron microscopy (TEM): Reveals structural abnormalities in viral factories when H7 is absent, including large electron-dense inclusions and aberrant D13 structures

  • Electron tomography (ET): Provides 3D visualization of D13 structures, showing that without H7, D13 forms an extensive network rather than the normal honey-comb lattice

  • Immunogold labeling: Identifies specific viral proteins within aberrant structures, confirming the mislocalization of D13 and membrane proteins

  • Pulse-chase experiments: Demonstrate defects in proteolytic processing of viral proteins when H7 is absent

  • Confocal microscopy: Tracks the localization of fluorescently tagged H7 and other viral proteins during infection

How can researchers assess which domains of H7 are critical for function?

Researchers have employed systematic mutagenesis to identify critical functional domains in H7:

H7-expression constructIV formationMV formationVirosomeNetwork
VACV H7ind + IPTG++
VACV H7ind-IPTG++
pEL-HA-H7 (full-length)++
pEL-HA-H7-R109E++
pEL-HA-H7-R117E/K128E++/−+/−
pEL-HA-H7-K108E/R109E/K112E++
pEL-HA-H7-119-146 (C-terminus only)++
pEL-HA-H7-1-114 (N-terminus only)++

This approach involves:

  • Creating truncated constructs expressing specific portions of H7 (e.g., N-terminus amino acids 1-114 or C-terminus 119-146)

  • Generating point mutations, particularly in charged amino acids that may be involved in interactions

  • Expressing these constructs in trans in cells infected with H7-deficient virus

  • Evaluating rescue of virus morphogenesis by assessing formation of immature virions (IVs) and mature virions (MVs)

Results indicate that both N- and C-terminal domains are essential, and specific charged residues in the putative PX domain are critical for function .

How does H7 influence the formation of the D13 lattice during viral morphogenesis?

H7 plays an unexpected but critical role in organizing the D13 scaffold protein into the characteristic honey-comb lattice required for viral membrane formation . In the absence of H7, D13 trimers assemble into a large, disordered 3D network rather than the well-organized scaffold layer observed in wild-type infection . Electron tomography reveals that without H7, D13 forms tube-like structures with regular striations, associated with the endoplasmic reticulum (ER) . This observation suggests that H7 is required not just for membrane biogenesis but specifically for the proper geometric arrangement of D13 into hexameric units that form the honey-comb lattice .

What happens to D13 organization when H7 is absent or mutated?

When H7 is not synthesized, several abnormal structures form:

  • Large electron-dense aggregates (virosomes) containing viral core proteins occasionally coated with short crescent-like membrane segments

  • Distinct network structures containing D13 and associated with ER membranes

  • D13 forming tubular structures with regular striations rather than the honey-comb lattice

  • The membrane protein A17, which normally interacts with D13, localizes to surrounding ER membranes rather than concentrating at sites of viral assembly

These observations indicate that H7 is required for the proper spatial organization of D13 into the hexameric units that form the scaffold for viral membrane assembly .

How does H7's ability to bind phosphoinositides relate to its function in D13 organization?

H7 contains a putative PX domain in its seventh α-helical domain that binds to phosphoinositides, particularly PI3P and PI4P . Mutagenesis studies show that positively charged amino acids in this domain (K108, R109, K112) are critical for H7 function:

  • The triple mutant substituting all three residues fails to rescue viral morphogenesis

  • Double mutations affecting lysine residues 128 and 143 impair formation of mature virions while still allowing some immature virion formation

  • Single mutations of these residues do not significantly affect assembly

These findings suggest that H7's ability to interact with membrane phospholipids through its PX domain is essential for its function in organizing D13 and facilitating viral membrane formation .

What is the relationship between H7 and other viral membrane-associated proteins?

H7 belongs to a group of five vaccinia virus proteins collectively called virus membrane associated proteins (VMAPs), which also includes A6, A11, L2, and A30 . These proteins are required for viral membrane biogenesis and the formation of infectious virus . Interestingly, when expression of A11 (another VMAP) is blocked, the phenotype is similar to that observed when H7 is absent: D13 accumulates in confined areas surrounded by closed ER cisternae, and crescent and immature virion formation is impaired . This suggests that VMAPs function in a coordinated manner during viral membrane formation, with H7 specifically involved in D13 organization .

How is H7 conserved across different poxviruses?

H7 is highly conserved among all chordopoxviruses, suggesting its essential role in the virus life cycle . Multiple alignments indicate that:

  • 96-100% of the H7 amino acid sequence is conserved among orthopoxviruses

  • 37-44% is conserved among other chordopoxvirus genera

This high degree of conservation, particularly among orthopoxviruses, indicates strong evolutionary pressure to maintain H7 function, reinforcing its critical role in viral replication .

What role does H7 play in the proteolytic processing of viral proteins?

In the absence of H7, viral late protein synthesis appears normal, but proteolytic processing of both membrane and core proteins is inhibited . Specifically:

  • The membrane protein A17 fails to undergo cleavage by the I7 protease, as shown by the presence of only the uncleaved form in Western blots

  • The core protein A3 similarly remains in its precursor form rather than being processed

  • This processing defect resembles that observed when cells are treated with rifampin, an inhibitor of vaccinia virus morphogenesis

The block in proteolytic processing indicates that H7 is required for an early step in morphogenesis that precedes and is necessary for the maturation of viral proteins .

How might the study of H7 inform our understanding of poxvirus evolution?

H7 represents an interesting case study in poxvirus evolution for several reasons:

  • It is conserved across all chordopoxviruses despite lacking obvious functional motifs or homologs outside poxviruses

  • Its role in organizing the D13 scaffold protein is crucial for the unique poxvirus assembly process that occurs in the cytoplasm

  • The interaction between H7 and the D13 scaffold may represent a poxvirus-specific adaptation for cytoplasmic assembly of large DNA viruses

Comparative studies of H7 across different poxvirus genera could provide insights into the evolution of the poxvirus assembly mechanism and how this family of viruses adapted to cytoplasmic replication .

What are the implications of H7's role for the development of attenuated poxvirus vectors?

Understanding H7's essential function has implications for the development of attenuated poxvirus vectors for vaccines:

  • Conditional expression of H7 could be used to create replication-deficient vectors that produce viral late proteins but cannot complete assembly

  • Such vectors would be safer than fully replication-competent viruses while still expressing a full complement of viral antigens

  • This approach differs from current attenuated vectors like Modified Vaccinia Ankara (MVA) or Non-replicating Vaccinia virus TianTan strain (NTV), which have deletions in multiple genes

The ability to selectively block assembly via H7 regulation while maintaining late gene expression could be valuable for vaccine development, as late proteins can induce protective neutralizing antibodies .

What experimental approaches might reveal the detailed mechanism of H7's interaction with D13?

Several advanced experimental approaches could further elucidate the mechanism of H7-D13 interaction:

  • Cryo-electron microscopy: Could visualize the molecular details of how H7 influences D13 hexamer formation at near-atomic resolution

  • In vitro reconstitution assays: Using purified H7 and D13 to determine if H7 directly promotes D13 hexamer formation or requires additional factors

  • Cross-linking mass spectrometry: To identify specific contact points between H7 and D13 or other interacting proteins

  • Single-particle tracking in live cells: To visualize the dynamics of H7-D13 interactions during viral assembly

  • Proximity labeling approaches: Such as BioID or APEX2 to identify the complete interactome of H7 during infection

These approaches could provide mechanistic insight into how a relatively small protein like H7 can dramatically influence the organization of the D13 scaffold and consequently viral membrane formation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.