Recombinant Vaccinia virus Myristoylated protein G9 (G9R)

Shipped with Ice Packs
In Stock

Description

Evolutionary Conservation

The high degree of conservation of G9 across the poxvirus family indicates its essential role in the viral life cycle. No non-poxvirus homologs have been detected through position-specific iterative BLAST searches, suggesting that G9 represents a unique adaptation specific to poxviruses . This evolutionary conservation underscores the importance of G9 in poxvirus biology and potentially identifies it as a distinctive target for antiviral strategies.

Essential Role in Viral Replication and Entry

Experimental evidence strongly supports the critical importance of G9 in vaccinia virus replication. Various approaches have been employed to elucidate its functional significance, including the construction of inducible mutants and gene deletion attempts.

Evidence for Essential Function

Attempts to isolate a mutant virus lacking the G9R gene have been unsuccessful, suggesting that the protein is essential for virus replication . To further investigate its role, researchers constructed a recombinant vaccinia virus (vG9i) in which G9R expression is regulated by an inducer (isopropyl-β-d-thiogalactopyranoside, IPTG). This inducible system allowed precise control over G9 expression levels during infection.

When G9 expression was repressed (by omitting IPTG), viral replication was severely compromised, with infectious virus yield reduced by approximately 1.5 logs compared to conditions where G9 expression was induced . This finding provided compelling evidence for the essential nature of G9 in the viral life cycle.

Role in Viral Entry and Membrane Fusion

G9-deficient virions demonstrated a dramatic reduction in specific infectivity, retaining less than 5% of normal levels. While these virions could still bind to host cells, their ability to penetrate the cytoplasm and initiate early viral RNA synthesis was severely impaired . Furthermore, G9-deficient virions failed to trigger cell-cell fusion under low pH conditions, a characteristic typically observed with wild-type vaccinia virus.

These observations position G9 as a critical component of the entry-fusion complex (EFC), a multi-protein assembly required for poxvirus entry into host cells. Of the identified components of this complex, G9 is the sixth that has been demonstrated to be essential for entry and membrane fusion processes .

Construction and Characterization of Recombinant G9R

The development of recombinant vaccinia viruses with regulated G9R expression has been instrumental in elucidating the protein's functions. These experimental systems have allowed researchers to manipulate G9 levels and analyze the resulting effects on viral replication and morphogenesis.

Engineering the vG9i Recombinant Virus

The construction of vG9i involved sophisticated genetic engineering techniques. This recombinant virus contains:

  1. An N-terminal HA epitope-tagged G9R open reading frame regulated by the bacteriophage T7 RNA polymerase promoter

  2. An open reading frame encoding enhanced green fluorescent protein (GFP) regulated by the vaccinia virus P11 late promoter

  3. Sequences flanking G9R for homologous recombination with the vaccinia virus genome

To prevent RNA polymerase read-through from neighboring genes, the G9R open reading frame was inserted in its natural site but in the opposite ("L") orientation. This design ensured that G9 expression would be tightly controlled by the inducer .

Attempts at G9R Deletion

Researchers attempted to delete the G9R open reading frame using the vaccinia virus bacterial artificial chromosome (BAC) system. This approach involved replacing the G9R gene with an ampicillin resistance gene in the VAC-BAC plasmid through recombination in Escherichia coli. Although ampicillin-resistant colonies were successfully isolated and the deletion of G9R was verified by sequencing, attempts to rescue the mutated VAC-BACΔG9 virus were unsuccessful .

This failure to isolate a G9R deletion mutant provided additional evidence for the essential nature of the protein. Only when intact G9R DNA was supplied along with the VAC-BACΔG9 DNA during transfection could infectious virus be rescued, confirming that G9 is either absolutely essential or that virus replication is too severely compromised without it to allow isolation by conventional methods .

Association with Viral Membranes and Surface Exposure

The localization and membrane association of G9 have been investigated using various biochemical and microscopic techniques, revealing important insights into its distribution within infected cells and mature virions.

Enrichment in Mature Virions

Western blot analysis of purified virions from cells infected with vG9i in the presence of IPTG revealed that G9 is significantly enriched in mature virions (MVs) compared to whole-cell extracts. Specifically, G9 was found to be enriched more than eightfold in MVs relative to the amount in whole-cell extracts. By comparison, A16 (another component of the entry-fusion complex) showed an even higher enrichment of more than 16-fold .

The relatively lower incorporation of G9 into MVs compared to A16 may reflect differences in expression kinetics or efficiency, possibly influenced by the inducible T7 promoter system used in the recombinant virus .

Surface Exposure on Mature Virions

To investigate the membrane association and surface exposure of G9, researchers employed a biotinylation approach. Mature virions purified from cells infected with vG9i were treated with sulfo-NHS-SS-biotin, a membrane-nonpermeating reagent that can only label proteins exposed on the virion surface.

After biotinylation, the virions were lysed, and biotinylated proteins were separated from non-biotinylated ones using NeutrAvidin beads. Western blot analysis revealed that in biotinylated MVs, G9 was almost entirely associated with the bound fraction, indicating its exposure on the virion surface . This finding confirms that G9 is not only incorporated into mature virions but is also accessible on their surface, where it can potentially participate in virus-host cell interactions during entry.

Impact on Viral Morphogenesis

Despite its essential role in viral entry, G9 appears to be dispensable for virion morphogenesis. Detailed microscopic and biochemical analyses have revealed that virion assembly proceeds normally even when G9 expression is repressed.

Electron Microscopic Evidence

Transmission electron microscopy of thin sections from cells infected with vG9i, either with or without IPTG, provided direct visual evidence that all stages of virion assembly occur normally regardless of G9 expression levels. The microscopic images revealed the presence of:

  1. Viral crescents and immature virions

  2. Mature virions (MVs)

  3. Cell-associated extracellular virions (EVs)

These observations confirm that while G9 is critical for viral entry, it does not significantly impact the morphogenesis pathway. This functional specialization may reflect the compartmentalization of different stages in the viral life cycle, with G9 playing a specific role in entry rather than assembly.

Adaptive Mutations in G9 and Their Functional Significance

Recent research has identified specific mutations in G9 that can enhance viral infection under certain conditions, particularly in cells expressing the fusion regulatory proteins A56 and K2. These findings provide valuable insights into the functional regions of G9 and its interaction with host cell factors.

Identification of Adaptive Mutations

Through serial passage of wild-type vaccinia virus in cells expressing A56/K2 (which normally imposes a block to viral entry), researchers identified several adaptive mutations in G9 that overcome this restriction . These mutations were concentrated near the N-terminus of G9 and included:

  1. Histidine to tyrosine substitution at position 44 (H44Y)

  2. Histidine to arginine substitution at position 44 (H44R)

  3. Tyrosine to cysteine substitution at position 42 (Y42C)

  4. Duplication of amino acids 26 to 39

Table 1 summarizes the frequency of these mutations observed across multiple independent passage series:

PassageNo. of clonesG9 H44YG9 H44RG9 26–39 duplication
A12903
B121110
C111100
D101000
Total4541/451/453/45

The H44Y mutation was by far the most frequent, appearing in 41 out of 45 isolates across all passage series. This suggests that this particular mutation confers a significant selective advantage under the experimental conditions employed.

Emergence and Enrichment of Adaptive Mutations

Whole-genome sequencing of viral DNA from different rounds of passage revealed the timeline of emergence for these adaptive mutations. The H44Y mutation was not detected at round 1 but reached frequencies of 63-76% by round 5 and 85-98% by round 9, indicating rapid selection once it appeared . In contrast, the H44R mutation and the amino acid duplication were found in only one of the four independent passages each, with frequencies of 9% and 10% respectively by round 9.

Table 2 shows the frequency of these mutations across different passage rounds:

RoundFrequency (%)
G9 H44YG9 H44RG9 26–39 duplication
Ap1000
Ap57605
Ap985010
Bp1000
Bp56350
Bp98590
Cp1000
Cp57100
Cp99600
Dp1000
Dp56500
Dp99800

This pattern of emergence and enrichment suggests that these mutations arose or were significantly enriched at different rates during the passages, with H44Y showing the strongest selective advantage.

Functional Impact of G9 Mutations on Viral Spread

The adaptive mutations identified in G9 significantly enhanced viral replication and spread in cells expressing A56/K2 fusion regulatory proteins. These effects were quantified through plaque size measurements and virus yield determinations.

Effects on Plaque Size

Plaque size analysis revealed that each of the G9 mutants produced significantly larger plaques than wild-type virus in A56/K2 cells. These differences in mean plaque sizes were statistically significant (p < 0.001) across three independent experiments . This increased plaque size indicates enhanced cell-to-cell spread of the mutant viruses, suggesting that the mutations enable more efficient viral entry or post-entry steps in A56/K2-expressing cells.

Interestingly, the G9 mutants also formed slightly larger plaques than wild-type virus in parent HEK-293 cells, although this effect was not consistently observed in BS-C-1 cells . This observation suggests that the mutations may confer a general replication advantage under certain cellular conditions, even in the absence of A56/K2 expression.

Impact on Virus Yield

When infected at low multiplicities of infection, the G9 mutants produced significantly higher virus yields than wild-type virus in A56/K2 cells after 24 hours . This finding provided further evidence that the identified mutations enhance viral replication and spread in cells expressing the fusion regulatory proteins.

The ability of these mutants to overcome the replication block imposed by A56/K2 suggests that the N-terminal region of G9 plays a critical role in mediating interactions with these fusion regulatory proteins. By altering these interactions, the mutations likely prevent the inhibitory effect of A56/K2 on viral entry and fusion, allowing more efficient infection and spread.

Interaction of G9 with Fusion Regulatory Proteins

The interaction between G9 and the fusion regulatory proteins A56 and K2 represents a critical aspect of poxvirus entry regulation. This interaction appears to be modulated by specific regions near the N-terminus of G9, as revealed by the adaptive mutations discussed above.

G9/A16 Subcomplex and A56/K2 Interaction

Previous studies showed that A56/K2 interacts with the G9/A16 entry-fusion complex subcomplex in detergent-treated cell extracts . This interaction is believed to regulate fusion activity, with A56/K2 potentially preventing superinfection and cell-cell fusion by blocking the function of the entry-fusion complex on newly infected cells.

The fact that adaptive mutations in G9, particularly near its N-terminus, can overcome the entry block imposed by A56/K2 provides functional evidence for the importance of this interaction. These findings suggest that the N-terminal region of G9 is directly involved in the interaction with A56/K2, and that modifications to this region can modulate the strength or nature of this interaction .

Significance for Viral Entry Regulation

The interaction between G9 and A56/K2 appears to represent an important regulatory mechanism for poxvirus entry. By expressing A56/K2 on the surface of infected cells, poxviruses may prevent superinfection and limit cell-cell fusion, which could be beneficial for viral spread and persistence in the host.

The adaptive mutations identified in G9 likely disrupt this regulatory mechanism, allowing the virus to enter cells despite the presence of A56/K2. This ability may represent an adaptation that enhances viral replication under specific conditions, such as in tissues where A56/K2 expression is high or in response to host defense mechanisms that upregulate these fusion regulatory proteins .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
G9R; Myristoylated protein G9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-340
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
G9R
Target Protein Sequence
GGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYP EFRLVNTGPGGLSALLRQSYNGTAPNCCRTFNRTHYWKKDGKISDKYEEGAVLESCWPDV HDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRSNRTVEGQQSLINLYNKMQTLCSKDA SVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPR ECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDRFST VPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI
Uniprot No.

Target Background

Function
The envelope protein of the entry-fusion complex; it mediates viral membrane fusion with the host cell membrane during viral entry. It also contributes to cell-cell fusion (syncytium formation).
Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the Vaccinia virus G9R protein and what are its key structural features?

The Vaccinia virus G9R gene (VACWR087) encodes a 340-amino acid protein with a molecular weight of approximately 38.7 kDa . G9R possesses several conserved structural features that are significant for its function:

  • An N-terminal myristoylation site that facilitates membrane association

  • 14 conserved cysteine residues that likely contribute to protein folding and stability

  • A C-terminal transmembrane domain that anchors the protein in viral membranes

G9R has been identified as one of eight proteins that form a putative entry-fusion complex, suggesting its critical role in virus-host cell interactions . Structurally, G9R shares some similarities with other VACV proteins including A16 and J5, though sequence homology is relatively low .

Why is G9R considered essential for Vaccinia virus replication?

G9R appears to be an essential component of the Vaccinia virus replication cycle based on multiple lines of evidence:

  • Attempts to delete the G9R gene using bacterial artificial chromosome (BAC) systems have been unsuccessful, strongly suggesting its essential nature .

  • When researchers attempted to generate a G9R deletion mutant (VAC-BACΔG9), no viable virus was recovered, even when using fluorescent microscopy to detect individual cells expressing the reporter gene .

  • The essential role was confirmed through rescue experiments where introduction of intact G9R gene to VAC-BACΔG9-transfected cells resulted in recovery of infectious virus .

To circumvent the inability to create a complete deletion mutant, researchers have successfully developed conditional expression systems (e.g., vG9i) where G9R expression is regulated by inducible promoters, allowing for controlled studies of its function .

How is G9R protein associated with mature virions?

G9R is significantly enriched in mature virions (MVs) compared to whole-cell extracts, indicating its specific incorporation into viral particles. Western blot analysis of purified virions showed that G9R is approximately 8-fold enriched in MVs relative to whole-cell extracts . For comparison, another entry-fusion protein, A16, showed a 16-fold enrichment in the same experiments .

The surface localization of G9R has been confirmed using membrane-impermeant biotinylation reagents, which can only label proteins exposed on the virion surface . This surface exposure is consistent with G9R's proposed role in the entry-fusion complex.

The relatively lower enrichment of G9R in MVs compared to A16 may be attributed to the experimental system used, where the inducible T7 promoter system can cause higher than normal and slightly delayed expression patterns .

How can researchers quantitatively assess G9R incorporation into virions?

To measure G9R incorporation into virions, researchers can employ several complementary techniques:

Western Blot Quantification:

  • Purify mature virions using sucrose gradient ultracentrifugation

  • Prepare whole-cell extracts from infected cells

  • Normalize samples by total protein amount

  • Perform SDS-PAGE and Western blotting using epitope-tag antibodies (e.g., anti-HA)

  • Use densitometry to calculate relative enrichment of G9R in virions versus whole-cell extracts

Comparing protein enrichment in virions:

ProteinEnrichment in MVs (fold increase compared to whole-cell extract)
G9R~8-fold
A16~16-fold

The lower relative enrichment of G9R may reflect technical aspects of the inducible expression system rather than biological significance .

What experimental approaches can determine G9R's membrane topology and surface exposure?

Understanding a viral protein's membrane topology is crucial for elucidating its function. For G9R, researchers have employed several approaches:

Surface Biotinylation:

  • Purify mature virions from induced cultures

  • Treat intact virions with membrane-impermeant biotinylation reagents

  • Perform Western blotting to detect biotinylated proteins

  • Include appropriate controls (cytosolic proteins should not be labeled)

Protease Protection Assays:
Though not explicitly mentioned in the provided sources, this complementary approach can determine which domains are exposed:

  • Treat intact virions with proteases that cannot penetrate membranes

  • Analyze digestion patterns by Western blotting

  • Protected fragments indicate regions inside the virion or embedded in the membrane

Transmembrane Domain Analysis:
Computational prediction combined with experimental validation can map the orientation of the C-terminal transmembrane domain of G9R .

How does G9R interact with other components of the entry-fusion complex?

The entry-fusion complex represents a critical machinery for poxvirus infection. To study G9R's role within this complex:

Co-immunoprecipitation Approaches:

  • Create recombinant viruses expressing epitope-tagged G9R

  • Prepare lysates from infected cells under conditions that preserve protein-protein interactions

  • Immunoprecipitate with antibodies against the epitope tag

  • Analyze co-precipitating proteins by mass spectrometry or Western blotting with antibodies against known complex components

Proximity Labeling Methods:
While not explicitly mentioned in the provided materials, proximity labeling techniques like BioID or APEX2 would be valuable for mapping the interaction network of G9R in living cells.

How can researchers evaluate the functional consequences of G9R depletion?

Using inducible expression systems like vG9i allows for controlled studies of G9R function:

Virus Yield Analysis:

  • Infect cells in the presence or absence of inducer (IPTG)

  • Harvest cells and media at different time points

  • Determine virus titers using plaque assays

  • Compare yields between induced and non-induced conditions

Results from such experiments indicate that omission of inducer (reducing G9R expression) decreases infectious virus yield by approximately 1.5 logs .

Morphogenesis Analysis:

  • Prepare infected cells with or without inducer for electron microscopy

  • Examine all stages of virus morphogenesis

  • Quantify different viral forms (immature virions, mature virions, etc.)

Interestingly, even with reduced G9R expression, all stages of virus morphogenesis appear normal and extracellular virions can be detected on the cell surface, suggesting G9R may play a more specific role in infectivity rather than assembly .

How is G9R conserved across the poxvirus family?

G9R represents a highly conserved protein across all members of the poxvirus family, suggesting its fundamental importance to the viral lifecycle:

Sequence Conservation:
The structural features of G9R, including 14 cysteine residues, the N-terminal myristoylation site, and C-terminal transmembrane domain, are conserved throughout poxviruses . This high degree of conservation across diverse poxvirus species strongly indicates functional importance.

Evolutionary Relationships:
G9R shares structural similarities with other poxvirus proteins, particularly A16 and J5, though sequence homology is relatively low . Both G9R and A16 have been experimentally confirmed to be myristoylated, suggesting conserved post-translational modification pathways .

Domain Conservation Analysis:

Structural FeatureConservation Across PoxvirusesFunctional Implication
N-terminal myristoylation siteHighly conservedMembrane association essential for function
14 cysteine residuesConserved patternLikely critical for protein folding/stability
C-terminal transmembrane domainPresent in all homologsMembrane anchoring required for activity

Notably, no non-poxvirus homologs of G9R have been detected through position-specific iterative BLAST searches, suggesting this protein represents a unique adaptation specific to the poxvirus family .

How does the study of G9R contribute to our understanding of poxvirus entry mechanisms?

The essential nature of G9R and its association with the entry-fusion complex provides insights into the molecular mechanisms of poxvirus entry:

G9R is one of eight proteins associated in a putative entry-fusion complex . Understanding the specific role of G9R within this complex helps elucidate how poxviruses initiate infection. The surface exposure of G9R on mature virions, confirmed through biotinylation experiments, indicates its potential role in direct interactions with host cell components during the entry process .

The inability to generate viable viruses lacking G9R highlights its critical role, and the specific defects observed in conditional mutants can reveal which stage of the entry process requires G9R function .

What are the best approaches for generating recombinant vaccinia viruses expressing modified G9R?

Creating recombinant vaccinia viruses with modified G9R proteins requires specialized methodologies:

Homologous Recombination Approach:

  • Design PCR products containing:

    • Modified G9R gene (e.g., with epitope tag)

    • Selectable marker (e.g., GFP under control of a viral promoter)

    • Flanking sequences homologous to the viral genome

  • Transfect PCR product into virus-infected cells

  • Select recombinant viruses forming green fluorescent plaques

  • Perform clonal purification through multiple rounds of plaque isolation

  • Verify recombination by PCR and sequencing

Bacterial Artificial Chromosome (BAC) System:
Though the provided sources indicate challenges with this approach for G9R deletion, the BAC system remains valuable for other modifications:

  • Manipulate the vaccinia genome as a BAC in bacterial cells

  • Perform recombination in the bacterial system

  • Transfect modified BAC DNA into mammalian cells with helper virus

  • Recover recombinant virus

What considerations are important when designing vaccine vectors based on G9R modifications?

When considering vaccine design involving G9R modifications, researchers should note:

Essential Nature:
The essential role of G9R means that complete deletion is not viable for attenuated vaccines . Instead, conditional expression or domain modifications might be more appropriate.

Surface Exposure:
G9R's confirmed surface exposure on virions makes it potentially accessible to antibodies, which could be relevant for vaccine-induced immunity .

Conserved Structure:
The high conservation of G9R across poxviruses suggests modifications that preserve function while enhancing immunogenicity would be most effective .

According to best practices in vaccine trial design, any modifications to viral vectors require rigorous evaluation of:

  • Safety endpoints

  • Immunogenicity

  • Efficacy against challenge

  • Population-specific responses

What are promising approaches for elucidating the precise molecular function of G9R?

Future research on G9R would benefit from several cutting-edge approaches:

Cryo-Electron Microscopy:
Determining the structure of G9R in the context of the entry-fusion complex would provide unprecedented insights into its molecular function.

Domain-Specific Mutagenesis:
Systematic mutation of conserved residues, particularly the 14 cysteines and the myristoylation site, could reveal which specific features are essential for different aspects of G9R function .

Host Interaction Screens:
Identifying host proteins that interact with G9R could reveal its role in entry, immune evasion, or other processes.

Single-Virus Fusion Assays:
Real-time imaging of virus entry using fluorescently labeled virions with wild-type or modified G9R could directly assess its role in membrane fusion events.

How might the study of G9R inform broader research on viral entry mechanisms?

The entry-fusion complex of poxviruses represents a unique machinery distinct from other viral families. Understanding G9R's role can:

  • Reveal conserved principles of viral membrane fusion

  • Identify novel targets for broad-spectrum antivirals

  • Provide insights into the evolution of viral entry mechanisms

  • Inform the design of viral vectors for vaccine delivery and gene therapy

The essential nature of G9R coupled with its surface exposure makes it particularly relevant for understanding the initial steps of poxvirus infection, which could have implications for other enveloped viruses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.