Recombinant Vaccinia virus Myristoylated protein G9 (MVA079R, ACAM3000_MVA_079)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Viral Biology

Research has revealed that the G9 protein plays a crucial role in the vaccinia virus life cycle, particularly in viral entry and morphogenesis processes.

Essentiality for Viral Replication

Attempts to isolate a mutant vaccinia virus lacking the G9R gene have been unsuccessful, strongly suggesting that the protein is essential for virus replication . To investigate this further, researchers constructed a recombinant vaccinia virus with inducible G9R expression. When G9 expression was repressed, infectious virus yield was reduced by approximately 1.5 logs (a reduction of about 97%) . This finding confirms that while some viral replication can occur with minimal G9 expression, optimal virus production requires normal levels of this protein.

Role in Entry-Fusion Complex

G9 has been identified as one of eight proteins associated in a putative entry-fusion complex, suggesting its involvement in the initial stages of viral infection . This complex is likely critical for the fusion of the viral envelope with host cell membranes, facilitating the entry of the viral core into the cytoplasm.

Virion Association and Surface Exposure

Experimental evidence demonstrates that G9 is associated with mature infectious virions and is enriched approximately eightfold in mature virions compared to whole-cell extracts . The protein can be labeled with membrane-impermeant biotinylation reagents, indicating that portions of G9 are exposed on the virion surface . This surface exposure is consistent with its proposed role in viral entry processes.

Impact on Viral Morphogenesis

Interestingly, despite the reduced viral yield in the absence of G9 induction, all stages of virus morphogenesis appeared normal upon electron microscopic examination . These observations included the presence of viral crescents, immature virions, mature virions, and cell-associated extracellular virions . Additionally, the processing of core protein precursors into their mature products occurred normally, further suggesting that G9 does not directly impact viral assembly but rather affects another aspect of the viral life cycle, most likely related to entry and infectivity .

Expression and Purification

Commercial recombinant G9 protein typically includes an N-terminal histidine tag (often a 10xHis tag) to facilitate purification using affinity chromatography . The recombinant protein usually encompasses the full length of the mature protein (residues 2-340), excluding only the initial methionine .

Stability and Handling Recommendations

Manufacturers consistently advise against repeated freeze-thaw cycles as they can significantly degrade protein quality and activity . It is recommended to aliquot the reconstituted protein to minimize freeze-thaw events . The shelf life of liquid preparations is generally around 6 months at -20°C/-80°C, while lyophilized forms may remain stable for up to 12 months under the same conditions .

Research Applications and Significance

The recombinant Vaccinia virus Myristoylated protein G9 has several important applications in virology research and potential therapeutic development.

Immunological Applications

Recombinant G9 protein serves as an important tool for generating antibodies against this viral component, facilitating immunological studies and diagnostic assay development . Its availability in pure form allows for more precise characterization of immune responses to vaccinia virus infection or vaccination.

Vaccine Development and Validation

Given the essential nature of G9 in viral replication, this protein represents a potential target for vaccine development against poxviruses . Recombinant G9 can be used to evaluate antibody responses following vaccination and to develop improved vaccines with enhanced safety and efficacy profiles.

Future Research Directions

The critical role of G9 in vaccinia virus biology suggests several promising avenues for future research:

Interaction Studies

Further investigation of G9's interactions with other viral proteins, particularly those in the entry-fusion complex, could elucidate the complete molecular machinery involved in poxvirus entry . Protein-protein interaction studies using the recombinant protein could identify key binding partners and functional domains.

Therapeutic Targeting

Given that G9 appears essential for optimal viral replication, it represents a promising target for antiviral drug development . High-throughput screening using recombinant G9 could identify compounds that disrupt its function or interactions, potentially leading to novel anti-poxvirus therapeutics.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing the order, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MVA079R; ACAM3000_MVA_079; Myristoylated protein G9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-340
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain Ankara) (VACV)
Target Names
MVA079R
Target Protein Sequence
GGRVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYP EFRLVNTGPGGLSALLRQSYNGTAPNCCRTFNRTHYWKKDGKISDKYEEGAVLESCWPDV HDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRSDRTVEGQQSLINLYNKMQTLCSKDA SVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPR ECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDRFST VPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI
Uniprot No.

Target Background

Function
This protein comprises the envelope protein component of the entry-fusion complex, responsible for mediating virus membrane fusion with the host cell membrane during virus entry. It also plays a role in cell-cell fusion (syncytium formation).
Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the role of G9 protein in Vaccinia virus replication?

G9 serves as a critical component of the entry/fusion complex (EFC) in poxviruses, including Vaccinia virus. The EFC consists of 11 conserved proteins embedded in the membrane envelope of mature virus particles and is responsible for mediating viral entry into host cells . G9 specifically forms a subcomplex with A16, another EFC protein, which interacts with the A56/K2 fusion regulatory complex . This interaction is crucial for controlling viral entry and preventing superinfection and cell-cell fusion. The functional significance of G9 has been demonstrated through experiments using cells expressing A56/K2, which impose a block to viral entry that can be overcome by mutations in G9 .

How does the myristoylation of G9 affect its function?

Myristoylation is a post-translational modification involving the addition of a 14-carbon fatty acid myristate group to the N-terminal glycine residue of proteins. In the case of G9, myristoylation appears to be important for proper membrane association and function within the EFC. Research has shown that mutations near the N-terminus of G9 (positions 42 and 44) do not affect myristoylation status, suggesting that this modification occurs independently of the regions involved in interactions with A56/K2 . The persistence of myristoylation despite these mutations indicates that this modification likely plays a structural role in anchoring G9 to viral membranes rather than directly mediating protein-protein interactions with fusion regulatory complexes.

What is known about the sequence conservation of G9 across different poxvirus strains?

G9 is highly conserved across the Poxviridae family, reflecting its essential role in viral entry. The protein's conserved nature makes it an important target for antiviral development and vaccine design. In the Modified Vaccinia Ankara (MVA) strain, the G9 homolog is designated as MVA079R (ACAM3000_MVA_079) . Sequence alignment studies have shown that the N-terminal region, particularly around amino acid positions 42-44, is highly conserved among orthopoxviruses, which explains why mutations in this region can significantly impact viral entry and fusion capabilities .

What methods are most effective for studying G9 protein-protein interactions?

Several complementary approaches have proven effective for investigating G9 interactions:

  • Co-immunoprecipitation (Co-IP): This technique has been successfully used to demonstrate the interaction between G9/A16 subcomplex and A56/K2 in detergent-treated infected cell lysates . For optimal results, researchers should use mild detergents (such as 1% NP-40 or 0.5% Triton X-100) to solubilize membrane proteins while preserving protein-protein interactions.

  • Yeast two-hybrid assays: While not explicitly mentioned in the search results, this system can be useful for mapping specific interaction domains within G9.

  • Experimental evolution approaches: Serial passage of wild-type virus in nonpermissive cells (expressing A56/K2) has been particularly informative, leading to the identification of adaptive mutations in G9 that overcome entry restrictions . This unbiased approach revealed functionally important residues that might not have been predicted through structural analysis alone.

  • Error-prone PCR mutagenesis: This method has been employed to generate additional mutations in G9, further clarifying the regions important for interaction with A56/K2 . The technique involved:

    • PCR amplification of either the entire G9 ORF or just the N-terminal portion

    • Transfection of the PCR products into A56/K2-expressing cells infected with VACV

    • Serial passage of progeny virus to enrich for adaptive mutations

    • Sequencing of large plaque isolates to identify beneficial mutations

How can researchers effectively express and purify recombinant G9 protein for structural studies?

  • Expression system selection: While E. coli can produce the basic protein, eukaryotic systems like insect cells or mammalian cells may be necessary to ensure proper myristoylation.

  • Solubilization strategies: Due to its membrane association, solubilization with detergents is typically required. A systematic approach testing different detergents (DDM, CHAPS, or OG) at various concentrations can help optimize extraction conditions.

  • Affinity purification: His-tagged versions of G9 can be purified using nickel affinity chromatography, followed by size exclusion chromatography to ensure homogeneity .

  • Stability considerations: The addition of glycerol (5-10%) and appropriate salt concentrations (150-300 mM NaCl) to buffers can help maintain protein stability during purification and storage.

  • Myristoylation verification: Mass spectrometry should be employed to confirm the presence of myristoylation, particularly when studying structure-function relationships of G9.

What are the methodological considerations for analyzing G9 mutations on viral entry?

Analyzing the effects of G9 mutations on viral entry requires a multi-faceted approach:

  • Luciferase reporter assays: Utilizing recombinant viruses that express luciferase under an early promoter (like WRvFire) provides a quantitative method for monitoring viral entry . This approach involves:

    • Infection of target cells with recombinant viruses

    • Measurement of luciferase activity at early time points (2 hours post-infection)

    • Normalization to control conditions

    • Statistical analysis to determine significant differences

  • Syncytium formation assays: G9 mutations can be evaluated for their effects on cell-cell fusion by infecting HeLa cells and observing syncytium formation at late times post-infection .

  • Homologous recombination validation: Introduction of specific G9 mutations into the viral genome through homologous recombination confirms their phenotypic effects . This involves:

    • PCR amplification of the G9 region with desired mutations

    • Transfection into cells infected with wild-type virus

    • Selection of recombinant viruses

    • Phenotypic characterization

  • Whole-genome sequencing: This approach ensures that observed phenotypes are due to the intended G9 mutations rather than secondary mutations elsewhere in the genome .

What specific mutations in G9 have been identified that affect viral entry and fusion?

Several key mutations in G9 have been identified through experimental evolution approaches:

  • H44Y mutation: This substitution was the most frequently observed adaptive mutation, occurring in 41 out of 45 clones analyzed across multiple independent passages . By round 5 of serial passage, the H44Y mutation reached frequencies of 63-76%, increasing to 85-98% by round 9 .

  • H44R mutation: This alternative substitution at position 44 was less common, found in only 1 out of 45 clones and reaching a frequency of only 9% by round 9 in one passage series .

  • Duplication of amino acids 26-39: This structural change was observed in 3 out of 45 clones from one passage series, reaching a frequency of 10% by round 9 .

  • Y42C mutation: This substitution was discovered through error-prone PCR mutagenesis rather than serial passage .

These mutations are summarized in the following table based on their discovery method and frequency:

MutationDiscovery MethodFrequency in ClonesPassage Frequency by Round 9
G9 H44YSerial passage41/4585-98%
G9 H44RSerial passage1/459% (in one passage)
G9 26-39 duplicationSerial passage3/4510% (in one passage)
G9 Y42CError-prone PCR7/30Not determined

How do different mutations in G9 affect its interaction with A56/K2 complex?

The G9 mutations appear to perturb the interaction with the A56/K2 fusion regulatory complex, although some association is still detectable in detergent-treated infected cell lysates . The functional consequences of these mutations include:

  • Enhanced viral entry: G9 mutants exhibit 4- to 10-fold higher luciferase expression in A56/K2 cells compared to wild-type virus, indicating improved core entry into the cytoplasm .

  • Syncytium formation capability: Unlike wild-type virus, G9 mutants can induce syncytia in HeLa cells despite the expression of A56/K2, suggesting that the mutations allow the EFC to overcome fusion regulation .

  • Persistence of some interaction: Biochemical studies indicate that G9 mutants still maintain some level of interaction with A56/K2, suggesting that the mutations modulate rather than completely abolish this interaction .

The clustering of adaptive mutations in the N-terminal region (positions 42-44 and the duplication of residues 26-39) suggests that this region is specifically involved in the interaction with A56/K2. The lack of adaptive mutations in other regions of G9 or in other EFC components like A16 further supports the specificity of this interaction interface .

What methodological approaches can detect subtle changes in G9 conformation resulting from mutations?

Detecting conformational changes in membrane proteins like G9 requires specialized techniques:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can reveal regions of differential solvent accessibility between wild-type and mutant G9, providing insights into conformational changes.

  • Limited proteolysis: Comparing the proteolytic fragmentation patterns of wild-type and mutant G9 can identify regions with altered structural exposure.

  • Antibody binding profiles: Panels of monoclonal antibodies targeting different epitopes can detect conformational changes through differential binding to wild-type versus mutant G9.

  • Crosslinking mass spectrometry: This approach can identify specific residues involved in interactions and how mutations alter these interaction landscapes.

  • Molecular dynamics simulations: While requiring structural information, computational approaches can predict how specific mutations might alter protein dynamics and interaction interfaces.

How does G9 contribute to the immunogenicity of MVA-based vaccines like ACAM3000?

ACAM3000 is a Modified Vaccinia Ankara (MVA) vaccine that has been evaluated in clinical trials for safety and immunogenicity . While the search results don't directly address G9's specific contribution to immunogenicity, we can infer several points:

  • Antigen presentation: As a component of the EFC, G9 is present on the viral envelope and potentially accessible to the immune system. Antibodies targeting G9 might contribute to neutralizing activity against MVA.

  • T-cell responses: Viral proteins like G9 can generate T-cell epitopes. In clinical trials of ACAM3000, T-cell immune responses to vaccinia virus were detected by IFN-γ ELISPOT, although these were not specifically attributed to G9 .

  • Role in viral entry: Since G9 is crucial for viral entry, antibodies targeting this protein might contribute to neutralizing both the intracellular mature virion (IMV) and extracellular enveloped virion (EEV) forms of vaccinia virus, both of which were measured in ACAM3000 clinical trials .

What is the optimal route of administration for MVA vaccines containing G9 protein, and how does this affect immune responses?

Clinical trials of ACAM3000 MVA have compared different routes of administration:

  • Intramuscular (IM): Tested at doses of 10^7 or 10^8 TCID50

  • Subcutaneous (SC): Tested at doses of 10^7 or 10^8 TCID50

  • Intradermal (ID): Tested at doses of 10^6 or 10^7 TCID50

The findings indicated that:

  • MVA was generally well tolerated by all routes, but more pronounced local reactogenicity was observed with ID and SC routes compared to IM administration .

  • ID immunization demonstrated a dose-sparing effect, eliciting antibody responses similar in magnitude and kinetics to those from IM or SC routes, but at a 10-fold lower dose .

  • All routes of administration generated binding antibodies to whole virus and neutralizing antibodies to IMV and EEV forms of vaccinia virus, with higher doses generating greater responses for each route .

  • T-cell immune responses were detected by IFN-γ ELISPOT but showed no clear relationship to dose or route .

These findings suggest that the ID route may be most efficient for generating antibody responses, potentially including those targeting G9 protein. The vaccination schedule in clinical trials involved a two-dose regimen at day 0 and day 28, which successfully boosted immune responses after the second immunization .

The route of administration information is summarized in this table from the clinical trial:

GroupNVaccineDoseRoute
A10ACAM3000 MVA10^6 TCID50ID
B10ACAM3000 MVA10^7 TCID50IM
C10ACAM3000 MVA10^7 TCID50SC
D10ACAM3000 MVA10^8 TCID50SC
E10ACAM3000 MVA10^7 TCID50ID
F10ACAM3000 MVA10^8 TCID50IM

How can G9 protein be utilized as a target for antiviral development against poxviruses?

G9's essential role in viral entry makes it an attractive target for antiviral development:

  • Structure-based drug design: Once structural information is available, computational approaches can identify small molecules that might interfere with G9's interaction with other EFC components or with the A56/K2 complex.

  • Peptide inhibitors: Synthetic peptides mimicking the N-terminal region of G9 (amino acids 26-44) might compete with native G9 for binding to A56/K2 or other interaction partners.

  • Monoclonal antibodies: Antibodies targeting accessible epitopes on G9 could potentially neutralize virus by preventing proper functioning of the EFC.

  • High-throughput screening: Assays measuring the interaction between G9 and A56/K2 could be developed to screen compound libraries for inhibitors.

  • Rational mutagenesis: Further characterization of the G9-A56/K2 interaction interface could reveal additional residues critical for viral entry that could serve as specific targets for intervention.

What role might G9 play in determining host range and cell tropism of poxviruses?

The EFC, of which G9 is a critical component, plays a key role in determining host range and cell tropism . Several lines of evidence suggest G9's potential importance:

  • Interaction with host factors: The ability of G9 to function properly in different cell types might depend on specific host factors that vary across species.

  • Regulation by A56/K2: The interaction between G9 and A56/K2 regulates viral entry and cell-cell fusion. Variations in this interaction might contribute to differences in host range.

  • Adaptive mutations: The fact that specific mutations in G9 can overcome entry restrictions imposed by A56/K2 suggests that G9 adaptation might contribute to host range expansion in natural settings .

  • Conservation across poxviruses: G9's high conservation indicates its fundamental importance in viral entry, but subtle sequence variations across viral species might fine-tune host specificity.

  • Myristoylation dependence: The requirement for N-myristoylation might vary across host cell types, potentially affecting viral fitness in different hosts.

How do experimental approaches for studying G9 differ between in vitro and in vivo systems?

Studying G9 function presents different challenges in vitro versus in vivo:

In vitro approaches:

  • Cell culture systems: Allow precise manipulation of both viral and cellular components, enabling detailed mechanistic studies of G9 function .

  • Recombinant protein expression: Facilitates biochemical and structural characterization of G9 and its interactions .

  • Syncytium formation assays: Provide a visual readout of fusion activity that can be quantified .

  • Luciferase reporter assays: Enable quantitative measurement of viral entry efficiency .

  • Mutagenesis approaches: Allow systematic exploration of structure-function relationships .

In vivo approaches:

  • Animal models: Required to assess the impact of G9 mutations on pathogenesis, spread, and immune responses in intact organisms.

  • Tissue-specific effects: In vivo systems can reveal differential effects of G9 variants on viral tropism for specific tissues.

  • Immune response complexity: Only in vivo models can fully capture the complex interplay between viral entry and host immune responses.

  • Safety assessment: Clinical trials like those conducted with ACAM3000 are necessary to evaluate safety and immunogenicity in humans .

  • Route of administration effects: As demonstrated with ACAM3000, the route of administration significantly impacts immune responses in vivo, something that cannot be fully modeled in vitro .

The complementary nature of in vitro and in vivo approaches suggests that a comprehensive understanding of G9 function requires integration of multiple experimental systems.

What are the key considerations for designing experiments to track G9 protein localization during infection?

Tracking G9 localization during the viral life cycle requires careful experimental design:

  • Antibody selection: Generation of specific antibodies against G9 that don't cross-react with host proteins or other viral components is crucial. Validation should include Western blotting and immunoprecipitation to confirm specificity.

  • Fluorescent protein tagging: Addition of fluorescent tags (GFP, mCherry) must be carefully positioned to avoid interfering with G9 function. C-terminal tagging may be preferable since N-terminal myristoylation is important for function .

  • Time course experiments: G9 localization should be examined at multiple time points post-infection to capture its dynamics during the viral life cycle.

  • Co-localization studies: Double-labeling with markers for different cellular compartments (plasma membrane, ER, Golgi) or viral structures (viral factories, mature virions) can reveal the trafficking pathway of G9.

  • Super-resolution microscopy: Techniques like STORM or PALM may be necessary to resolve G9 localization within the complex architecture of viral particles.

  • Live-cell imaging: For dynamic studies of G9 trafficking, live-cell approaches using minimally disruptive tags are preferable.

  • Electron microscopy: Immunogold labeling can provide ultrastructural localization of G9 within viral particles.

What approaches can resolve contradictory data regarding G9 protein interactions?

When faced with contradictory data about G9 interactions, several approaches can help resolve discrepancies:

  • Multiple interaction detection methods: Employ complementary techniques (co-IP, proximity labeling, FRET, SPR) to validate interactions under different conditions.

  • Controlled expression levels: Ensure that protein overexpression doesn't create artificial interactions by using inducible expression systems or knock-in approaches.

  • Detergent conditions: Systematically vary detergent types and concentrations, as membrane protein interactions are highly sensitive to solubilization conditions .

  • Domain mapping: Determine specific interaction domains through truncation and point mutation analysis to distinguish direct from indirect interactions.

  • Temporal considerations: Assess interactions at different time points during infection, as they may be dynamic.

  • Cell type dependence: Test interactions in multiple cell types to determine if host factors influence interaction patterns.

  • Viral strain variations: Compare interactions across different poxvirus strains to identify conserved versus strain-specific interaction networks.

  • Competitive binding assays: Determine if contradictory interaction partners compete for the same binding site or can simultaneously bind to G9.

How can researchers distinguish between direct and indirect effects of G9 mutations on viral phenotypes?

Distinguishing direct from indirect effects of G9 mutations requires a multi-faceted approach:

  • Biochemical interaction studies: Direct measurement of G9-A56/K2 binding affinity using purified components can determine if mutations directly affect this interaction .

  • Restoration experiments: Complementation with wild-type G9 expression in trans can determine if mutant phenotypes can be rescued.

  • Secondary site suppressors: Identification of compensatory mutations in interaction partners that restore function can map interaction networks.

  • Structural studies: Determining how mutations affect G9 structure can distinguish between direct effects on binding interfaces versus indirect conformational changes.

  • Kinetic analyses: Measuring the rate of viral entry can distinguish between effects on binding versus post-binding events.

  • Single-cycle growth curves: Detailed analysis of different stages of the viral life cycle can pinpoint where mutant phenotypes first emerge.

  • Whole-genome sequencing: As performed in the study of G9 mutations, this approach ensures that observed phenotypes are not due to secondary mutations elsewhere in the genome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.