Recombinant Vaccinia virus Myristoylated protein G9 (VACWR087)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vaccinia Virus Myristoylated Protein G9 (VACWR087)

Recombinant Vaccinia virus Myristoylated protein G9, encoded by the VACWR087 gene, is a crucial component of the poxvirus entry-fusion complex. This protein plays a significant role in the replication and infectivity of the vaccinia virus, a member of the poxvirus family. The G9 protein is characterized by its structural features, including a site for N-terminal myristoylation, 14 cysteine residues, and a C-terminal transmembrane domain .

Table 1: Key Features of Recombinant Vaccinia Virus Myristoylated Protein G9 (VACWR087)

FeatureDescription
GeneVACWR087
Protein Length340 amino acids
Molecular WeightApproximately 38.7 kDa
Myristoylation SiteN-terminal
Transmembrane DomainC-terminal
FunctionEssential for viral replication and entry-fusion complex

Expression and Production

Recombinant G9 protein is produced in various expression systems, including E. coli and yeast. The protein is often tagged with a His-tag for purification and identification purposes. The recombinant protein is available in both liquid and lyophilized forms, with a purity of greater than 90% as determined by SDS-PAGE .

Table 2: Production Details of Recombinant Vaccinia Virus Myristoylated Protein G9

Expression SystemTagPurityForm
E. coliN-terminal His-tag>90%Lyophilized powder
YeastC-terminal 6xHis-tag>90%Liquid or lyophilized powder

Research Findings and Significance

Studies have shown that the G9 protein is indispensable for the replication of vaccinia virus. Attempts to delete the G9R gene resulted in a significant reduction in infectious virus yield, highlighting its critical role in viral morphogenesis and infectivity . The protein's involvement in the entry-fusion complex underscores its importance in the viral life cycle.

Table 3: Research Highlights on Recombinant Vaccinia Virus Myristoylated Protein G9

Study FocusKey Findings
Role in Viral ReplicationEssential for virus replication and entry-fusion complex
Expression and LocalizationAssociated with mature infectious virions, surface-exposed
Deletion StudiesSignificant reduction in infectious virus yield upon G9R gene deletion

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VACWR087; G9R; Myristoylated protein G9; Protein F1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-340
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR087
Target Protein Sequence
GGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYP EFRLVNTGPGGLSALLRQSYNGTAPNCCRTFNRTHYWKKDGKISDKYEEGAVLESCWPDV HDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRSNRTVEGQQSLINLYNKMQTLCSKDA SVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPR ECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDRFST VPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI
Uniprot No.

Target Background

Function

The envelope protein of the entry-fusion complex is responsible for viral membrane fusion with the host cell membrane during viral entry. It also plays a role in cell-cell fusion (syncytium formation).

Database Links

KEGG: vg:3707543

Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the structural composition of the G9 protein?

The G9R gene (VACWR087) encodes a 340-amino-acid protein with a molecular weight of approximately 38.7 kDa. Key structural features include 14 conserved cysteine residues, a site for N-terminal glycine myristoylation (following the consensus sequence MGXXXS/T), and a C-terminal transmembrane domain. These features are highly conserved across the poxvirus family, indicating their functional importance . While G9 shares structural similarities with other viral proteins like A16 and J5, sequence homology is relatively low, and no significant non-poxvirus homologs have been detected through position-specific iterative BLAST searches .

Is the G9 protein essential for vaccinia virus replication?

Yes, evidence strongly suggests that G9 is essential for virus replication. Attempts to isolate mutants lacking the G9R gene have been unsuccessful, indicating its crucial role in the viral life cycle . Experimental approaches using inducible systems demonstrate that when G9 expression is reduced, infectious virus yield decreases by approximately 1.5 logs, further supporting its essential nature . Understanding this essentiality provides important context for researchers designing inhibitors or studying viral replication mechanisms.

How is the G9 protein associated with the virion structure?

G9 protein is enriched in mature virions (MVs) compared to whole-cell extracts, with studies showing an approximately eightfold enrichment in purified virions relative to cellular content . The protein exhibits membrane association and surface exposure, as demonstrated through biotinylation experiments. When mature virions were treated with sulfo-NHS-SS-biotin (a membrane-nonpermeating reagent), G9 was almost entirely recovered in the bound fraction, confirming its exposure on the virion surface . G9 forms part of a putative entry-fusion complex with other viral proteins, suggesting a role in viral entry into host cells.

What experimental approaches can be used to study G9 protein function?

To investigate G9 function, researchers should employ a systematic experimental design approach that manipulates specific variables while controlling for confounding factors. Inducible expression systems represent a powerful method, as demonstrated by studies where G9R was placed under control of an inducible promoter . When designing such experiments, researchers should:

  • Clearly define independent variables (e.g., presence/absence of inducer) and dependent variables (e.g., virus yield, morphogenesis stages)

  • Control for extraneous variables that might affect results (e.g., cell type, infection conditions)

  • Formulate specific, testable hypotheses about G9 function

  • Design complementary approaches to verify findings, such as combining genetic, biochemical, and imaging techniques

For example, a comprehensive study might combine an inducible expression system with electron microscopy to analyze morphogenesis, membrane biotinylation to assess surface exposure, and co-immunoprecipitation to identify protein interactions.

How can researchers characterize mutations in the G9 protein?

Analysis of G9 mutations, particularly those near the N-terminus, requires rigorous methodology. Researchers have identified several key mutations including H44Y, H44R, and Y42C through directed evolution approaches . When characterizing such mutations:

  • Implement whole-genome sequencing across multiple viral passages to track mutation emergence and frequency (see Table 1)

  • Clone and isolate individual mutant viruses to confirm phenotypes

  • Perform comparative growth analyses between wild-type and mutant viruses

  • Evaluate protein-protein interactions to determine if mutations affect binding partners

Table 1: Frequency of G9 Mutations Across Viral Passages

RoundFrequency (%)
G9 H44YG9 H44RG9 26–39 duplication
1000
563-760-50-5
985-980-90-10
Clonal isolates100 (D111)100 (B411)100 (A211)

The data demonstrates how mutations can emerge at different rates during passage, with H44Y appearing earlier and reaching higher frequencies (85-98% by passage 9) compared to other mutations .

What methods are most effective for analyzing G9 protein localization?

Determining the subcellular and virion localization of G9 requires complementary approaches:

How should researchers design studies to investigate G9 interactions with other viral proteins?

When studying protein-protein interactions involving G9, researchers should:

  • Define clear hypotheses: Based on G9's role in the entry-fusion complex, formulate specific hypotheses about interaction partners .

  • Select appropriate detection methods: Co-immunoprecipitation, proximity ligation assays, or yeast two-hybrid approaches may be suitable depending on the research question.

  • Control for experimental variables: When manipulating G9 expression or structure, carefully control for changes in virus replication or protein expression that might confound results .

  • Consider membrane context: Since G9 is a membrane-associated protein, interactions should be studied in appropriate detergent conditions that maintain membrane protein associations.

  • Validate interactions through multiple methods: Confirm findings using orthogonal approaches such as genetic complementation studies or mutational analyses.

A well-designed experimental workflow might begin with broad interaction screening followed by targeted validation and functional characterization of specific interaction partners.

What are the key considerations when generating recombinant viruses expressing modified G9 proteins?

Creating recombinant vaccinia viruses with modified G9 requires careful planning:

  • Preserve essential functions: Since G9 is essential for replication, modifications should be designed to maintain critical functional domains. The consensus myristoylation site (MGXXXS/T) and transmembrane domains are particularly important .

  • Use inducible systems: When studying potentially detrimental modifications, inducible expression systems provide valuable control. Techniques employing the T7 RNA polymerase/lac operator system have proven effective for G9 studies .

  • Verify genetic integrity: Confirm recombinant constructs through PCR and sequencing to ensure no unwanted mutations are introduced during recombination.

  • Quantify expression levels: Compare modified G9 expression to wild-type levels, as over- or under-expression may affect interpretation of results.

  • Assess virion incorporation: Verify that modified G9 proteins are incorporated into virions at appropriate levels through purification and Western blot analysis .

How can researchers effectively evaluate G9 myristoylation and its functional significance?

N-terminal myristoylation of G9 appears critical for function. To study this modification:

  • Metabolic labeling: Incorporate radioactive or clickable myristate analogs to directly detect myristoylated G9.

  • Site-directed mutagenesis: Generate glycine-to-alanine mutations at position 2 to prevent myristoylation, then assess the impact on localization and function.

  • Mass spectrometry: Use targeted proteomics approaches to identify and quantify myristoylated peptides.

  • Inhibitor studies: Apply myristoylation inhibitors and assess effects on G9 localization and virus replication.

  • Comparative analysis: Since both G9 and A16 are myristoylated , comparative studies may reveal shared functional requirements for this modification.

What experimental design approaches are most suitable for analyzing G9 mutations that affect viral fitness?

When analyzing how G9 mutations impact viral fitness:

  • Design multi-factorial experiments: Consider how mutations might interact with variables like cell type, temperature, or other viral proteins .

  • Implement competition assays: Mixed infections with wild-type and mutant viruses can reveal subtle fitness differences through multiple passages.

  • Use appropriate statistical analyses: Plan for adequate biological replicates and appropriate statistical tests to detect significant differences in fitness measures .

  • Sequence validation: Regularly sequence viral populations to monitor for compensatory or reversion mutations that might emerge during passage .

The frequency distribution of mutations across passages (as shown in Table 1) highlights how certain mutations (like H44Y) may confer selective advantages, appearing earlier and reaching higher frequencies compared to others .

How should researchers assess experimental reliability when studying G9 protein functions?

Statistical reliability is essential for G9 research. Researchers should:

  • Apply appropriate reliability measures: Use metrics like Cronbach's α to assess internal consistency of experimental results across replicates .

  • Ensure adequate discrimination power: Calculate metrics like average R-ir to determine how well experiments distinguish between different conditions or treatments .

  • Implement diverse experimental designs: Combine multiple approaches (e.g., genetic, biochemical, structural) to triangulate findings.

  • Control for positive cueing: Guard against biased interpretation of results by implementing blinded analysis where possible .

  • Validate across systems: Confirm findings in multiple cell types or using complementary experimental systems.

By implementing these methodological considerations, researchers can ensure robust and reproducible findings in G9 protein studies, advancing our understanding of this essential vaccinia virus component.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.