Recombinant Vaccinia virus Protein A34 (A34R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
A34R; Protein A34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
A34R
Target Protein Sequence
MKSLNRQTVSMFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYL DTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNNKWLDINNDKD IDISKLTNFKQLNSTTDAEACYIYKSGKLVKTVCKSTQSVLCVKKFYK
Uniprot No.

Target Background

Function

Essential for the envelopment of intracellular viral particles and the egress of enveloped virions from infected cells.

Protein Families
Chordopoxvirinae A34 protein family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

Basic Research Questions

What is the functional role of A34 in vaccinia virus morphogenesis?

A34 is a type II transmembrane glycoprotein critical for extracellular virion (EV) maturation and infectivity. Key functions include:

  • Regulating EV release: A34-deficient mutants (e.g., vΔA34R) produce 19–24× more extracellular enveloped virions (EEV) but with 5–6× reduced specific infectivity due to unstable envelopes .

  • Actin tail induction: A34 enables intracellular transport by promoting actin polymerization, a process abolished in A34R deletion mutants .

  • Protein targeting: A34 mediates efficient incorporation of B5, A33, and A36 glycoproteins into EV membranes. In its absence, B5 accumulates in the endoplasmic reticulum (ER) .

Methodological insight: Use coimmunoprecipitation (e.g., anti-HA tagged A34) and immunofluorescence to validate interactions with B5/A36 .

How does A34’s structure influence its function?

A34 contains two domains essential for activity:

DomainFunctionExperimental Evidence
EctodomainBinds B5 via SCR motifsTruncation mutants (e.g., A34Δ70–130) show disrupted B5 interaction .
Cytoplasmic tailMediates actin tail formationDeletion abolishes actin polymerization .
TransmembraneAnchors protein to EV membraneHA-tagged A34 retains membrane localization .

Methodological insight: Generate truncation mutants (e.g., vA34R1–70-V5) and compare phenotypes using plaque assays .

Advanced Research Questions

How do contradictory observations about A34’s role in EV release arise?

While A34 deletion increases EEV yield, these virions exhibit reduced infectivity. Contradictions stem from:

  • Envelope stability: A34 stabilizes the EV membrane. Its absence causes premature envelope rupture, releasing non-infectious IMV .

  • Experimental models: Cell type differences (e.g., B-SC-1 vs. HeLa) alter wrapping efficiency, skewing EEV quantification .

Methodological resolution: Quantify infectious EEV via freeze-thaw resistance assays and normalize data to total virion counts .

What strategies identify A34’s interaction partners in the EV envelope?

A34 forms a complex with B5 and A33, validated by:

  • Coimmunoprecipitation: Anti-HA antibodies pull down B5 and A36 from lysates of vA34RHA-infected cells .

  • Colocalization assays: Dual immunofluorescence shows A34/B5/A33 overlap at trans-Golgi network (TGN) wrapping sites .

  • Genetic complementation: Coexpression of A34 with B5-GFP rescues B5’s ER retention in ΔA34R mutants .

Methodological insight: Use recombinant viruses (e.g., vB5R-GFP/ΔA34R) and subcellular fractionation to track protein trafficking .

How can A34 mutations resolve conflicting data on EV dissemination?

Point mutations in A34’s lectin-like domain (e.g., IHDJ strain) enhance EEV release without compromising infectivity . Key approaches include:

  • Site-directed mutagenesis: Introduce residues (e.g., D81N) to alter glycan binding .

  • Phenotypic screening: Compare plaque size, actin tail formation, and EEV stability across mutants .

Example data:

MutantEEV Yield (vs. WT)Specific InfectivityActin Tail Formation
ΔA34R24× ↑16% of WTAbsent
A34-HA1.5× ↑85% of WTReduced
A34 (IHDJ)50× ↑95% of WTPresent

Experimental Design Considerations

  • Controls: Include parental WR virus and revertants (e.g., WR-rev) to distinguish A34-specific effects .

  • Quantification: Use dual-fluorescent reporters (e.g., rsGFP/RFP) to track infection and transfection efficiency .

  • Limitations: A34’s redundancy with F13 in IMV wrapping may confound phenotyping; use double knockouts cautiously .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.