Recombinant Vaccinia virus Protein OPG162 (OPG162)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VACWR157; A34R; SALL4R; Protein A34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR157
Target Protein Sequence
MKSLNRQTVSRFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYL DTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKD IDISKLTNFKQLNSTTDAEACYIYKSGKLVKTVCKSTQSVLCVKKFYK
Uniprot No.

Target Background

Function
Essential for the envelopment of intracellular viral particles and the egress of enveloped virions from infected cells.
Gene References Into Functions
  1. Studies using various mutant viruses indicated that EV membranes lacking the A34 protein remained intact. PMID: 17553539
  2. Research confirmed that B5 and A34 interact via their luminal domains. Further analysis revealed that, without A34, B5 is not efficiently incorporated into virions released from the cell. PMID: 18094183
  3. The envelope of A34-deficient virus contained normal levels of F13 but reduced amounts of A33 and B5 compared to the parental WR virus. This suggests that A34 is a key determinant in the protein composition of the vaccinia virus envelope. PMID: 18094186
Database Links

KEGG: vg:3707687

Protein Families
Chordopoxvirinae A34 protein family
Subcellular Location
Virion membrane; Single-pass type II membrane protein.

Q&A

What is the fundamental process for constructing recombinant vaccinia viruses for therapeutic applications?

Recombinant vaccinia viruses are engineered by inserting foreign genes into the viral genome through homologous recombination. The process typically involves:

  • Selection of an appropriate vaccinia strain as the backbone (e.g., the Wyeth vaccine strain)

  • Design of a transfer vector containing the target gene flanked by vaccinia sequences

  • Co-infection of cells with parental vaccinia virus and transfection with the transfer vector

  • Selection and purification of recombinant viruses through marker genes

  • Verification of correct insertion and expression of the foreign gene

The construction methodology has been successfully demonstrated in various therapeutic applications, such as the development of TA-HPV, a recombinant vaccinia virus expressing modified forms of E6 and E7 proteins from HPV16 and HPV18 for cervical cancer immunotherapy .

How is protein expression verified in newly constructed recombinant vaccinia viruses?

Verification of recombinant protein expression involves multiple complementary techniques:

  • Western blot analysis: Using antibodies specific to either the inserted protein or an epitope tag (such as HA or V5) that has been fused to the protein. For example, in studies with vA34R-HA, Western blot analysis confirmed the presence of a protein with the expected electrophoretic mobility that reacted with anti-HA antibody .

  • Immunofluorescence microscopy: To visualize expression patterns and subcellular localization of the recombinant protein within infected cells.

  • Functional assays: To confirm biological activity of the expressed protein, which varies depending on its nature.

  • Mass spectrometry: For more detailed characterization of the expressed protein, particularly when post-translational modifications are relevant.

  • Plaque phenotype analysis: In some cases, expression of functional proteins can be verified through changes in plaque morphology compared to parental or deletion mutant viruses .

What safety parameters should be assessed when developing recombinant vaccinia viruses for therapeutic use?

Several critical safety parameters must be evaluated:

  • Neurovirulence assessment: Recombinant vaccinia viruses should ideally demonstrate reduced neurovirulence compared to parental virus. Studies with TA-HPV in mice showed the recombinant virus was less neurovirulent than the parental virus, which was essential for progression to human trials .

  • Biodistribution studies: Understanding where the virus localizes in the body after administration to identify potential off-target effects.

  • Immunogenicity profile: Evaluating both the immune response against the vaccinia vector and the inserted therapeutic gene product.

  • Genetic stability: Ensuring the recombinant virus maintains the inserted foreign gene through multiple passages.

  • Potential for recombination with wild-type viruses: Assessing the risk of genetic exchange with other viruses that could alter virulence characteristics.

How does epitope tagging facilitate research with recombinant vaccinia viruses?

Epitope tagging provides several methodological advantages:

  • Simplified protein detection: By adding well-characterized epitopes like HA or V5, researchers can use commercially available antibodies for detection rather than developing protein-specific antibodies.

  • Protein-protein interaction studies: Tags enable co-immunoprecipitation experiments to identify interaction partners. For example, a recombinant vaccinia virus expressing HA-tagged A34 protein was used to identify interactions with B5 and A36 proteins .

  • Protein localization: Epitope tags enable immunofluorescence studies to track protein distribution within cells and virions.

  • Affinity purification: Tags facilitate protein isolation for biochemical and structural studies.

  • Functional assessment: Comparison of tagged and untagged proteins can reveal whether the tag affects protein function. For instance, when A34 protein was tagged with an HA epitope, researchers verified functionality by comparing plaque size with wild-type and deletion mutant viruses .

How can protein-protein interactions involving vaccinia virus proteins be effectively mapped?

Mapping protein-protein interactions requires sophisticated methodological approaches:

  • Domain mapping through mutational analysis: Researchers can create a series of truncated or mutated proteins to identify essential interaction domains. For example, studies with recombinant vaccinia viruses expressing mutated versions of B5 protein demonstrated that the cytoplasmic and transmembrane domains were dispensable for binding to A34, while the extracellular domain containing short consensus repeats was sufficient for interaction .

  • Co-immunoprecipitation with epitope-tagged proteins: This approach allows identification of protein complexes in infected cells. The use of epitope-tagged proteins (such as HA-tagged A34) enables specific precipitation and identification of interaction partners .

  • Immunofluorescence co-localization: Provides spatial information about potential protein interactions within infected cells or viral particles.

  • Bimolecular fluorescence complementation: Allows visualization of protein interactions in living cells.

  • Proximity labeling methods: Techniques like BioID or APEX can identify proteins in close proximity to the protein of interest.

  • Crosslinking mass spectrometry: Provides detailed information about interaction interfaces at the amino acid level.

What experimental approaches are used to determine the impact of specific viral proteins on virion composition?

Determining protein composition impacts requires methodical investigation:

  • Construction of deletion or tagged mutants: Generating recombinant viruses lacking specific proteins or expressing tagged versions to study their effect on virion composition.

  • Comparative virion analysis: Purification of virions from wild-type and mutant viruses followed by protein analysis using:

    • Western blotting to quantify specific proteins

    • Mass spectrometry for comprehensive proteomic profiling

    • Immunoelectron microscopy to visualize protein distribution

  • Immunofluorescence analysis: Examining the incorporation of various viral proteins into developing virions in infected cells. For example, immunofluorescence experiments with A34-deficient virus revealed that A34 is required for efficient targeting of B5, A36, and A33 into wrapped virions .

  • Functional assays: Assessing changes in virion properties such as:

    • Cell-to-cell spread (plaque size)

    • Infectivity per particle

    • Stability under different conditions

  • Quantitative analysis: Measuring the relative amounts of viral envelope proteins. Studies showed that A34-deficient virus contained normal amounts of F13 but decreased amounts of A33 and B5 compared to wild-type virus, indicating A34's role as a major determinant in vaccinia virus envelope protein composition .

How can researchers design effective immunogenicity studies for recombinant vaccinia viruses expressing therapeutic antigens?

Designing robust immunogenicity studies requires careful methodological planning:

  • Comprehensive immune response assessment:

    • Humoral immunity: Measuring antibody titers, isotype distribution, neutralizing capacity, and specificity

    • Cellular immunity: Evaluating CD4+ and CD8+ T cell responses, including cytotoxic T lymphocyte (CTL) activity through ELISpot, intracellular cytokine staining, and cytotoxicity assays

    • Cytokine profiling: Characterizing the cytokine environment to understand Th1/Th2/Th17 polarization

  • Dose optimization protocol:

    • Testing multiple virus doses to establish dose-response relationships

    • Determining minimum effective dose and optimal dose for maximal response

    • Evaluating potential dose-limiting toxicities

  • Temporal analysis:

    • Assessment of response kinetics including onset, peak, and duration

    • Long-term memory formation evaluation

    • Booster response characteristics

  • Comparison controls:

    • Empty vector controls to distinguish vector from insert-specific responses

    • Comparisons with other delivery platforms expressing the same antigen

    • Benchmarking against established standards where available

In the case of TA-HPV, researchers assessed the ability of the recombinant virus to induce HPV-specific CTL responses in mice, providing essential preclinical data that supported progression to human trials in cervical cancer patients .

What methodologies are most effective for evaluating the genetic stability of recombinant vaccinia viruses?

Genetic stability assessment requires rigorous methodological approaches:

How can recombinant vaccinia viruses be optimized for cancer immunotherapy applications?

Optimization for cancer immunotherapy requires systematic methodological approaches:

  • Antigen engineering strategies:

    • Modification of tumor antigens to enhance immunogenicity

    • Removal of immunosuppressive domains

    • Creation of epitope-enhanced variants

    • Development of multi-antigen constructs to limit escape variants

  • Vector enhancement methods:

    • Incorporation of immunostimulatory molecules (cytokines, costimulatory factors)

    • Deletion of viral immunomodulatory genes that suppress host responses

    • Selection of vector backbone with appropriate immunogenicity profile

    • Strategic promoter selection for optimal antigen expression

  • Delivery optimization:

    • Evaluation of different administration routes (intratumoral, subcutaneous, intravenous)

    • Prime-boost strategies with heterologous vectors

    • Dosing schedule optimization for sustained immune responses

  • Combination therapy approaches:

    • Sequential or concurrent administration with checkpoint inhibitors

    • Integration with conventional treatments (radiation, chemotherapy)

    • Combination with adoptive cell therapies

The development of TA-HPV for cervical cancer immunotherapy exemplifies this approach, with the virus designed to express modified E6 and E7 proteins from HPV16 and HPV18 to induce immune responses against these oncoproteins commonly present in cervical tumors .

What techniques can researchers use to modify the tropism of recombinant vaccinia viruses for targeted applications?

Modifying viral tropism involves sophisticated engineering approaches:

  • Envelope protein modifications:

    • Mutation or deletion of viral envelope proteins to alter natural tropism

    • Insertion of ligands or single-chain antibodies to target specific receptors

    • Creation of chimeric envelope proteins combining domains from different viruses

  • Transcriptional targeting:

    • Use of tissue-specific promoters to restrict transgene expression

    • Incorporation of microRNA target sequences to de-target specific tissues

    • Implementation of two-component transcriptional systems for conditional expression

  • Capsid or envelope display technologies:

    • Genetic incorporation of targeting peptides into viral structural proteins

    • Adapter systems using bispecific antibodies

    • Chemical conjugation of targeting moieties to purified virions

  • Post-entry restrictions:

    • Engineering viral dependence on tissue-specific factors for replication

    • Incorporation of tissue-specific protease sites in essential viral proteins

    • Use of tissue-specific microRNA-regulated viral essential genes

  • Evaluation methodologies:

    • In vitro tropism assessment across diverse cell panels

    • Ex vivo tissue slice models for complex tissue architecture

    • In vivo biodistribution studies using reporter gene-expressing viruses

    • Comparative efficacy studies in appropriate disease models

What methodological considerations are important for transitioning recombinant vaccinia virus constructs from preclinical to clinical studies?

Transitioning to clinical studies requires rigorous methodological planning:

  • Manufacturing and quality control considerations:

    • Development of GMP-compliant production processes

    • Establishment of release specifications for identity, purity, potency, and safety

    • Stability studies under conditions relevant to clinical use

    • Development of validated analytical methods for product characterization

  • Preclinical data package requirements:

    • Pharmacokinetics/biodistribution in relevant animal models

    • Toxicology studies with appropriate dosing and observation periods

    • Immunogenicity assessments predictive of human responses

    • Efficacy data in disease-relevant models

  • Clinical trial design elements:

    • Appropriate patient population selection based on preclinical findings

    • Dose escalation strategy informed by animal studies

    • Safety monitoring parameters based on toxicology findings

    • Biomarker strategy for mechanism confirmation and efficacy prediction

  • Regulatory considerations:

    • Pre-IND/IND consultation strategy

    • Risk assessment and risk mitigation planning

    • Environmental risk assessment for recombinant organisms

    • Long-term follow-up planning for gene therapy products

The preclinical evaluation of TA-HPV established its safety profile, immunogenicity, and potential efficacy, creating a foundation for the initiation of human trials in cervical cancer patients .

What are the key factors affecting recombinant protein expression levels in vaccinia virus systems?

Several methodological factors influence expression levels:

  • Promoter selection considerations:

    • Early vs. late vs. synthetic early/late promoters for timing of expression

    • Promoter strength based on consensus sequence optimization

    • Promoter context including spacing from transcription start site

    • Tissue-specific promoters for targeted expression

  • Insert design optimization:

    • Codon optimization for the host cell system

    • Removal of cryptic splice sites and unwanted regulatory elements

    • Signal sequence selection for secreted or membrane proteins

    • Optimization of translation initiation context

  • Insertion site selection:

    • Identifying non-essential regions that tolerate large inserts

    • Evaluating the impact of surrounding genomic elements

    • Considering the transcriptional landscape at potential insertion sites

    • Avoiding sites known to affect virus replication or virulence

  • Vector backbone features:

    • Selection of appropriate strain (e.g., WR, MVA, Wyeth strain)

    • Consideration of existing mutations or deletions in the backbone

    • Evaluation of backbone-specific effects on transgene expression

  • Expression verification methodologies:

    • Quantitative Western blotting

    • ELISA for secreted proteins

    • Flow cytometry for cell surface proteins

    • Functional assays specific to the protein of interest

How can researchers effectively characterize the impact of recombinant protein expression on vaccinia virus replication and spread?

Characterization requires systematic methodological approaches:

  • Growth curve analysis:

    • Multi-step growth curves in relevant cell types

    • Single-step growth curves to separate replication from spread

    • Quantification of both intracellular and extracellular virus

    • Comparison between recombinant and parental viruses

  • Plaque phenotype characterization:

    • Plaque size measurement as indicator of cell-to-cell spread

    • Plaque morphology assessment for changes in cytopathic effect

    • Comparison under different overlay conditions

    • Comet assay for released virus visualization

  • Actin cytoskeleton interaction assessment:

    • Visualization of actin tail formation using fluorescent phalloidin

    • Live-cell imaging of virus movement on actin structures

    • Quantification of the number and length of actin tails

    • Effects on cell-to-cell virus transmission

  • Microscopy approaches:

    • Transmission electron microscopy to examine virion morphogenesis

    • Confocal microscopy to track intracellular viral factories

    • Super-resolution microscopy for detailed structural analysis

  • Quantitative metrics:

    • Replication rate constants

    • Burst size (virus yield per infected cell)

    • Specific infectivity (particle-to-PFU ratio)

    • Cell-to-cell spread rate

For example, studies with vA34R-HA revealed that addition of the HA epitope to A34 resulted in smaller plaques compared to wild-type virus but substantially larger plaques than the A34 deletion mutant, indicating partial retention of function important for virus cell-to-cell transmission .

What methodological approaches are most effective for analyzing interactions between recombinant vaccinia virus proteins and host cell factors?

Analyzing virus-host interactions requires sophisticated methodological approaches:

  • Proteomics-based approaches:

    • Immunoprecipitation followed by mass spectrometry (IP-MS)

    • Proximity labeling methods (BioID, APEX) for identifying proteins in close proximity

    • Protein crosslinking methods to capture transient interactions

    • SILAC or TMT labeling for quantitative assessment of binding dynamics

  • Genetic screening techniques:

    • CRISPR/Cas9 screens to identify essential host factors

    • siRNA/shRNA screens to identify host proteins affecting viral replication

    • cDNA overexpression screens to identify restrictive or enhancing factors

    • Genetic complementation studies in different cell types

  • Imaging-based methods:

    • Co-localization studies using confocal microscopy

    • Live-cell imaging with fluorescently tagged proteins

    • Förster resonance energy transfer (FRET) for direct interaction detection

    • Fluorescence recovery after photobleaching (FRAP) for dynamics assessment

  • Functional validation strategies:

    • Domain mapping to identify critical interaction regions

    • Mutagenesis of key residues to disrupt specific interactions

    • Creation of chimeric proteins to transfer interaction capabilities

    • Competition assays with soluble protein domains

  • Bioinformatics approaches:

    • Motif identification in viral proteins that match host interaction domains

    • Structural modeling of potential interaction interfaces

    • Evolutionary analysis to identify conserved interaction surfaces

    • Network analysis of virus-host protein interactions

How should researchers interpret differences in immune responses elicited by different recombinant vaccinia virus constructs?

Interpretation requires rigorous analytical approaches:

The interpretation of HPV-specific CTL responses induced by TA-HPV in preclinical studies provided crucial insights that supported progression to clinical trials .

What analytical methods can be used to compare the genetic stability of different recombinant vaccinia virus constructs?

Comparative stability analysis requires robust analytical frameworks:

  • Sequence-based comparison metrics:

    • Mutation frequency per base pair per generation

    • Deletion/insertion frequencies in foreign sequences

    • Hotspot identification for mutation or recombination

    • Selective pressure analysis using dN/dS ratios

  • Expression stability metrics:

    • Quantitative expression level tracking across passages

    • Variance analysis to identify constructs with consistent expression

    • Half-life calculations for expression stability

    • Threshold determination for minimum functional expression

  • Comparative visualization approaches:

    • Mutation mapping across the viral genome

    • Insert stability heat maps comparing multiple constructs

    • Temporal stability plots showing expression retention over passages

    • Statistical process control charts for monitoring stability parameters

  • Predictive modeling:

    • Regression models to predict long-term stability

    • Machine learning approaches to identify sequence features predictive of stability

    • Risk assessment frameworks based on stability parameters

    • Time-to-failure analysis for different construct designs

  • Statistical analysis frameworks:

    • ANOVA for comparing stability metrics across multiple constructs

    • Survival analysis for time-to-instability data

    • Non-inferiority testing against reference constructs

    • Multivariate analysis incorporating multiple stability indicators

What emerging technologies might enhance the utility of recombinant vaccinia viruses in therapeutic applications?

Several innovative methodological approaches show promise:

  • Advanced genome engineering technologies:

    • CRISPR/Cas9-assisted recombination for more efficient virus construction

    • Synthetic biology approaches for rational design of viral backbones

    • Large-scale DNA synthesis enabling completely synthetic virus construction

    • Multiplexed genome editing for creating multi-gene modified vectors

  • Novel delivery and targeting strategies:

    • Cell-based carrier systems for enhanced delivery to tumors

    • Polymer or lipid encapsulation for immune evasion and targeted delivery

    • Bispecific antibody targeting for enhanced specificity

    • Magnetic nanoparticle guidance for localized delivery

  • Immunomodulatory enhancements:

    • Incorporation of designer cytokines with optimized properties

    • Expression of engineered T cell engagers for enhanced immune recruitment

    • Integration of metabolism-modifying enzymes to alter tumor microenvironment

    • Chimeric antigen receptor (CAR) expression systems for in situ CAR-T generation

  • Controllable expression systems:

    • Optogenetic regulation of transgene expression

    • Small molecule-inducible promoters for dose titration

    • miRNA-regulated expression for tissue-specific control

    • Synthetic biological circuits for context-dependent expression

  • Combination with emerging immunotherapy approaches:

    • Integration with personalized neoantigen vaccines

    • Combination with emerging immune checkpoint inhibitors

    • Synergy with adoptive cell therapies

    • Enhancement of natural killer cell recruitment and activation

How might systematic protein engineering enhance recombinant vaccinia virus functionality for therapeutic applications?

Protein engineering offers methodological opportunities:

  • Viral surface protein modifications:

    • Rational design of envelope proteins with altered receptor binding

    • Development of protease-activatable surface proteins for conditional infectivity

    • Creation of chimeric proteins incorporating domains from other viruses

    • Modification of antigenic determinants to reduce vector immunity

  • Therapeutic antigen optimization:

    • Epitope enhancement through strategic amino acid substitutions

    • Creation of epitope strings optimized for processing and presentation

    • Development of self-assembling nanoparticle antigens for improved immunogenicity

    • Incorporation of molecular adjuvant domains into antigen sequences

  • Viral replication machinery modification:

    • Engineering conditional dependence on specific cellular factors

    • Development of temperature-sensitive variants for controllable replication

    • Creation of polymerase variants with altered fidelity or speed

    • Modification of viral factories to enhance replication efficiency

  • Immunomodulatory protein optimization:

    • Engineering cytokines with enhanced half-life or receptor specificity

    • Development of membrane-tethered vs. secreted variants of immune modulators

    • Creation of conditional immunomodulators activated in specific microenvironments

    • Design of novel immune checkpoint inhibitors targeting unexplored pathways

  • Methodological approaches for design and validation:

    • Computational protein design and molecular dynamics simulations

    • High-throughput screening of protein variant libraries

    • Directed evolution approaches for function optimization

    • Structure-guided rational design based on crystallographic data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.