Recombinant Vaccinia virus Protein E8 (E8R)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vaccinia Virus Protein E8 (E8R)

Recombinant Vaccinia virus Protein E8, also known as E8R, is a protein encoded by the E8R gene in the vaccinia virus (VACV) . Vaccinia virus, a member of the poxvirus family, is unique because its transcription and DNA replication occur in the host cell's cytoplasm . The E8R protein is a structural component of the vaccinia virus, playing a role in the virus's life cycle and replication .

Expression and Synthesis of E8R

E8R is synthesized during the late stages of vaccinia virus infection . Unlike some reports suggesting early expression, research indicates that E8 protein appears approximately 6 hours post-infection and persists throughout the infection course in cells infected with wild-type VACV or mutant viruses . Experiments using cytosine arabinoside (CAR), which inhibits intermediate and late gene expression, confirm E8R's late expression pattern, similar to the late vaccinia virus protein L4R .

Characteristics and Localization of E8R

E8R is associated with the endoplasmic reticulum (ER) and membranes near the Golgi complex early in infection . Later in the infection process, E8R is found with immature virion membranes and intracellular mature viruses . Furthermore, E8R is associated with viral cores, present in cores made with NP-40-dithiothreitol and incoming cores early in infection .

E8R and Viral Transcription

E8R plays a role in virion core structure, which impacts core transcription either directly or indirectly . Mutant virions with reduced amounts of E8 display a high particle-to-infectivity ratio, suggesting that E8 is necessary for efficient viral replication . While soluble extracts from mutant virions are active in promoter-dependent in vitro transcription assays, intact mutant cores are defective in transcription .

Interaction with Host Proteins

Host ProteinInteractionReference
Endoplasmic Reticulum (ER)Localization and Interaction in wrapping process
Golgi ComplexMembrane Association

Mutants of E8R

Temperature-sensitive mutants, such as Dts23 and Cts19, have been instrumental in studying E8R function . Dts23, when grown at non-permissive temperatures, produces virions with reduced E8 content and impaired infectivity . Cts19 is also defective in generating infectious particles, even at permissive temperatures .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
E8R; Protein E8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
E8R
Target Protein Sequence
MAATVPRFDDVYKNAQRRILDQETFFSRGLSRPLMKNTYLFDNYAYGWIPETAIWSSRYA NLDASDYYPISLGLLKKFEFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSAL PTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYK PLFSRLKENYIFTGPVPICIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLL FYVPGYSITTKITPAVEYLMDKLNLTKSDVQLL
Uniprot No.

Target Background

Function

Function: Early in infection, this protein is packaged into virion cores and may play a role in viral factory biogenesis by recruiting and encapsulating DNA replication sites within endoplasmic reticulum-derived membranes. Later, phosphorylation by the viral kinase F10L may reduce its DNA-binding affinity and trigger ER membrane disassembly. It exhibits in vitro DNA-binding activity.

Protein Families
Chordopoxvirinae E8 family
Subcellular Location
Virion. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host cytoplasm.

Q&A

What is the E8R protein and what is its role in vaccinia virus replication?

E8R is a vaccinia virus-encoded protein that plays a critical role in the formation of functional virions. Research has demonstrated that E8R is a virion structural protein synthesized exclusively during the late phase of infection and is subsequently packaged into virion cores. The protein appears to play a subtle but essential role in maintaining virion core structure, which directly or indirectly impacts core transcription capabilities . Temperature-sensitive mutants in the E8R gene produce virions with significantly reduced infectivity, highlighting its importance in the viral life cycle .

What is the temporal expression pattern of E8R during vaccinia virus infection?

Contrary to earlier reports suggesting early expression, definitive research using western blot analysis with anti-E8 antibodies has established that E8R is a post-replicative (late) gene. The E8 protein first appears approximately 6 hours post-infection and persists throughout the infection course . This late expression pattern has been confirmed through experiments with cytosine arabinoside (CAR), which inhibits DNA replication and consequently late gene expression. Similar to other late proteins like L4, E8 accumulation is inhibited by CAR treatment, confirming its classification as a late gene product .

How does the subcellular localization of E8R change during infection?

Electron microscopy studies of infected cells reveal that E8R exhibits dynamic localization patterns throughout infection. As early as 1 hour post-infection, the protein localizes to the endoplasmic reticulum (ER) and to membranes on one side of the Golgi complex. Later in infection, E8R additionally associates with membranes of immature virions and with intracellular mature viruses . Despite its predominant membrane association, E8R is also present in viral cores, including those formed with NP-40-dithiothreitol and in incoming cores during early infection .

What mutations in the E8R gene affect vaccinia virus replication, and what phenotypes do they produce?

Research has identified specific mutations in the E8R gene that confer temperature-sensitive phenotypes. Two notable mutants are:

  • Dts23/Dts25: Contains a C to T transition at nucleotide 241, resulting in a leucine to phenylalanine substitution at codon 81 (L81F). This mutant shows reduced synthesis of E8 at both permissive (31°C) and non-permissive temperatures (39.7°C) .

  • Cts19: Has a G to A transition at nucleotide 3, substituting an isoleucine for the initiating methionine (M1I). This mutation abolishes the translation initiation codon, with the next possible initiation codon located 90 nucleotides downstream. This is considered a null mutant with no detectable E8 synthesis under any conditions .

Phenotypically, these mutants show normal patterns of gene expression and DNA replication but differ in their morphogenetic development. Dts23 virions produced at non-permissive temperature appear morphologically normal but contain reduced amounts of E8 and show high particle-to-infectivity ratios. Cts19 completely fails to produce identifiable viral structures at non-permissive temperature and produces virions with reduced infectivity even at permissive temperature .

How do E8R mutants affect viral entry and early gene expression?

Detailed studies have shown that Dts23 mutants grown at non-permissive temperature (39.7°C) can enter cells but fail to synthesize early mRNA or produce cytopathic effects. While soluble extracts from mutant virions remain active in promoter-dependent in vitro transcription assays, intact mutant cores are defective in transcription . This suggests that the E8R mutation affects the structural integrity of the viral core in a way that specifically impairs the core transcription machinery after entry into cells, rather than affecting the transcription components themselves.

What techniques are effective for detecting and characterizing E8R expression?

Several complementary techniques have proven effective for E8R research:

  • Western Blot Analysis: Using anti-E8 anti-peptide antibodies to track protein synthesis and accumulation during infection. This method allows detection of E8 from approximately 6 hours post-infection and can be used to compare expression levels between wild-type and mutant viruses .

  • Cytosine Arabinoside (CAR) Treatment: To determine the temporal class of E8R gene expression. CAR inhibits DNA replication and consequently intermediate and late gene expression, allowing researchers to distinguish between early versus late patterns of expression .

  • Electron Microscopy of Labeled Cryosections: For studying the subcellular localization of E8R throughout infection. This technique has revealed the association of E8R with cellular membranes and viral structures at different stages of the viral life cycle .

  • Two-Dimensional Gel Electrophoresis: For analyzing post-translational modifications of E8R. This approach has shown that E8R appears as a single spot throughout most of the viral life cycle but undergoes several modifications in the assembled virion that change its molecular weight and isoelectric point .

What are the methodological considerations for studying E8R interactions with other proteins?

The study of E8R protein-protein interactions requires robust methodological approaches:

  • Yeast Two-Hybrid (Y2H) Screening: This approach has been successfully used to identify potential interactions between vaccinia virus proteins and host proteins. When studying E8R interactions, it's important to note that Y2H has limitations, including a significant rate of false positives .

  • Validation of Y2H Hits: To confirm genuine interactions, secondary validation methods are essential. GST pull-down assays have shown a 63% validation rate for Y2H-identified interactions between vaccinia and human proteins, making this a valuable confirmatory approach .

  • ORFeome Library Construction: The development of Gateway-compatible vaccinia ORFeome libraries greatly facilitates protein interaction studies. These resources allow convenient transfer of cloned ORFs from entry vectors to various destination expression vectors for different experimental systems .

For optimal results when studying E8R interactions, researchers should:

  • Express proteins with different epitope tags (GST, HA, Myc-His) for pull-down experiments

  • Use multiple independent validation methods

  • Consider both in vivo and in vitro interaction systems

  • Account for the membrane association properties of E8R when designing experiments

What are the known post-translational modifications of E8R and how do they affect its function?

E8R undergoes several post-translational modifications:

  • Phosphorylation: E8R can be phosphorylated in vitro by the viral kinase F10L . This modification may play a regulatory role in E8R function, particularly in modulating its DNA-binding activity.

  • Virion-Specific Modifications: When E8R is incorporated into assembled virions, it undergoes additional modifications that result in changes to both its molecular weight and isoelectric point, as revealed by two-dimensional gel electrophoresis .

The functional significance of these modifications appears to include:

  • Potential regulation of DNA binding capability

  • Possibly influencing interactions with cellular membranes and other viral proteins

  • Likely contributing to the structural role of E8R in virion core formation

These modifications may represent important regulatory mechanisms controlling E8R activity during different stages of the viral life cycle.

How does E8R interact with cellular membranes and what domains are responsible?

E8R has been reported to contain two putative transmembrane domains that likely mediate its association with membrane structures during infection . The protein localizes to multiple membrane compartments, including:

  • Endoplasmic reticulum (ER) cisternae

  • Membranes on one side of the Golgi complex

  • Membranes of immature virions

  • Intracellular mature viruses

While initial reports suggested E8R might mediate interactions between ER cisternae and developing DNA factories , subsequent phenotypic analysis of temperature-sensitive mutants has not fully supported this model. Nevertheless, the membrane association properties of E8R appear to be important for its functions in the viral life cycle, possibly in coordinating membrane recruitment during virion assembly.

How might E8R's ability to bind DNA relate to its role in viral core transcription?

E8R has been demonstrated to bind DNA in vitro, and this binding may be modulated by phosphorylation by the viral kinase F10L . This biochemical property could be mechanistically linked to the observed defects in core transcription in E8R mutants. Several hypotheses could explain this relationship:

  • E8R might serve as a structural protein that properly positions viral DNA within the core for optimal access by the transcription machinery.

  • It might directly interact with components of the viral transcription apparatus to facilitate their assembly or function on the viral genome.

  • E8R could potentially act as a transcriptional regulator, either enhancing or repressing specific viral genes through its DNA binding activity.

To investigate these possibilities, researchers could employ techniques such as:

  • DNA-protein interaction assays with purified E8R protein

  • Chromatin immunoprecipitation to identify specific DNA sequences bound by E8R

  • Transcriptomic analysis comparing wild-type and E8R mutant infections

  • Structural studies of E8R-containing viral cores

What is the structural and functional relationship between E8R and other core proteins in the vaccinia virion?

Understanding the structural integration of E8R within the complex architecture of vaccinia virus cores represents an important research question. Current data indicate that E8R plays a subtle role in core structure that impacts transcriptional activity , but the precise molecular mechanisms remain unclear.

Potential approaches to address this question include:

  • Cryo-electron Microscopy: To visualize the localization of E8R within the core structure and its spatial relationship to other core components.

  • Protein-Protein Interaction Studies: To identify direct binding partners of E8R among other core proteins.

  • Complementation Analyses: Using conditional mutants to determine functional relationships between E8R and other core components.

  • Comparative Analysis: Examining E8R homologs across different poxviruses to identify conserved structural features that might indicate important functional domains.

The complex architecture of poxvirus cores makes this a challenging but important area of investigation that could reveal fundamental principles of viral genome packaging and transcriptional regulation.

How can understanding E8R function contribute to poxvirus-based vaccine vector development?

Vaccinia virus serves as an important platform for recombinant vaccine development. Understanding E8R function has several potential applications in this field:

  • Attenuation Strategies: Since E8R mutants show defects in viral replication while maintaining normal patterns of gene expression, engineered modifications in E8R could potentially be used to create attenuated vaccine vectors with enhanced safety profiles.

  • Improving Immunogenicity: If E8R influences the presentation of viral antigens or the activation of innate immune responses, modifications to this protein could potentially enhance vaccine immunogenicity.

  • Temperature-Sensitive Vectors: The temperature-sensitive phenotypes of E8R mutants could be exploited to develop conditionally replicating vectors for specific applications.

  • Protein Expression Optimization: Knowledge of E8R's role in viral transcription could inform strategies to optimize heterologous gene expression in vaccinia-based vectors.

Research examining these possibilities would need to carefully characterize the immunological consequences of E8R modifications and their effects on vector stability and expression of recombinant antigens.

What techniques are most effective for studying the impact of E8R mutations on virion assembly and infectivity?

The study of E8R's role in virion assembly and infectivity requires a multi-faceted approach:

  • Electron Microscopy: Both transmission electron microscopy of infected cells and cryo-EM of purified virions are essential for visualizing morphological defects associated with E8R mutations .

  • Plaque Assays and Growth Curves: To quantitatively assess the impact of mutations on viral replication and spread .

  • Particle-to-PFU Ratio Determination: To measure the specific infectivity of virions produced under different conditions .

  • In Vitro Transcription Assays: Using purified virions or viral cores to assess transcriptional competence .

  • Viral Entry Assays: To distinguish between defects in cell entry versus post-entry steps .

  • Proteomics Analysis: To determine if E8R mutations affect the incorporation of other viral proteins into virions.

  • Live-Cell Imaging: Using fluorescently tagged virion components to track assembly dynamics in real time.

The comprehensive application of these techniques allows researchers to dissect the specific stages of the viral life cycle affected by E8R mutations and to determine the molecular mechanisms underlying observed phenotypes.

Comparative Analysis of E8R Mutant Phenotypes

MutantGenetic ChangeE8 Protein ExpressionDNA ReplicationVirion MorphologyInfectivityCore Transcription
Wild-typeN/ANormal (from 6h post-infection)NormalNormalHighActive
Dts23L81F (nt 241 C→T)Reduced at both 31°C and 39.7°CNormalNormal at 39.7°CReduced (high particle-to-PFU ratio)Defective in intact cores
Cts19M1I (nt 3 G→A)Absent at both 31°C and 39.7°CNormalNo visible viral structures at 39.7°CSeverely reduced even at 31°CNot determined

This table synthesizes key findings from temperature-sensitive mutant characterization studies and provides a framework for understanding the phenotypic consequences of E8R mutations.

Temporal Expression Profile of E8R Compared to Other Vaccinia Genes

GeneProteinExpression TimingInhibited by CARVirion AssociationFunction
E8RE8Late (6h post-infection)YesPresent in coresCore structure/transcription
F11LF11Early (2h post-infection)NoNot determinedNot specified in source
L4RL4Late (5h post-infection)YesCore proteinDNA binding/packaging

This table contextualizes E8R expression within the broader framework of vaccinia gene expression patterns , highlighting its classification as a late gene product.

What are the optimal approaches for generating recombinant E8R for biochemical studies?

The production of recombinant E8R protein for in vitro studies presents several challenges due to its membrane association properties. Based on available research methodologies, the following approaches are recommended:

  • Gateway Cloning System: Utilizing Gateway-compatible entry vectors to transfer the E8R ORF into various expression vectors allows flexibility in experimental design . This approach facilitates:

    • Expression with different tags (GST, HA, Myc-His)

    • Testing in multiple expression systems

    • Rapid adaptation to different experimental needs

  • Expression Systems:

    • Bacterial Expression: May be useful for fragments lacking transmembrane domains

    • Baculovirus/Insect Cell System: Often preferable for full-length viral membrane proteins

    • Cell-Free Expression Systems: Can be effective for difficult-to-express proteins

    • In Vitro Transcription/Translation: The TNT Coupled Transcription/Translation System has been successfully used for E8R expression

  • Purification Strategies:

    • Include appropriate detergents when working with full-length E8R

    • Consider expressing functional domains separately

    • Use affinity purification with careful optimization of binding and elution conditions

These approaches should be tailored to the specific research questions being addressed and the particular biochemical properties being investigated.

How can researchers effectively study E8R-host protein interactions in the context of viral infection?

To comprehensively investigate E8R interactions with host proteins during infection, researchers should implement a multi-faceted strategy:

  • Initial Screening Methods:

    • Yeast two-hybrid (Y2H) screening has successfully identified vaccinia-host protein interactions

    • Affinity purification coupled with mass spectrometry (AP-MS) from infected cells

    • Proximity labeling approaches such as BioID or APEX

  • Validation Techniques:

    • GST pull-down assays have shown a 63% validation rate for Y2H hits

    • Co-immunoprecipitation from infected cells

    • FRET or BiFC for analyzing interactions in living cells

    • Liposome binding assays for membrane-associated interactions

  • Functional Analysis:

    • siRNA knockdown of identified host partners

    • CRISPR/Cas9 knockout of interaction candidates

    • Overexpression of dominant-negative constructs

    • Peptide inhibitors targeting specific interaction interfaces

  • Spatiotemporal Analysis:

    • Live-cell imaging to track interaction dynamics

    • Immunofluorescence microscopy at different infection timepoints

    • Subcellular fractionation followed by co-immunoprecipitation

By combining these approaches, researchers can build a comprehensive understanding of how E8R interfaces with host cellular machinery during the viral replication cycle, potentially identifying new antiviral targets or revealing fundamental aspects of virus-host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.