Recombinant Vaccinia virus Protein H2 (H2R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
H2R; Protein H2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
H2R
Target Protein Sequence
MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELT RYMRIKNTVNDWKSLTDSKTKLESDRGKLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYL PQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPH WCSDFSNME
Uniprot No.

Target Background

Function
This envelope protein is part of the entry-fusion complex. It mediates viral membrane fusion with the host cell membrane during viral entry and also plays a role in cell-cell fusion (syncytium formation).
Protein Families
Poxviridae H2 family
Subcellular Location
Virion membrane; Single-pass type III membrane protein.

Q&A

What is the Vaccinia virus H2 protein and why is it significant?

The H2 protein is encoded by the H2R gene (designated VACWR 100 in the WR strain) of vaccinia virus and is highly conserved in all sequenced members of the poxvirus family. It is a 21.5-kDa protein with a predicted transmembrane domain and four invariant cysteines . The high conservation of the H2R gene in all poxviruses suggests it has an essential role in viral function. Studies with recombinant vaccinia viruses have demonstrated that H2 is specifically required for virus entry into host cells . In the absence of H2 protein, the virus cannot replicate or spread to neighboring cells despite producing morphologically normal virions . The significance of H2 lies in its role as one of only two proteins (along with A28) presently known to be specifically required for vaccinia virus entry, functioning as components of a fusion complex .

What are the structural characteristics of H2 protein?

H2 protein exhibits several distinctive structural features:

  • It is a type II transmembrane protein with the transmembrane domain located approximately 30 amino acids from the N-terminus

  • Contains four invariant cysteines that form two intramolecular disulfide bridges

  • Crystal structure analysis reveals the ectodomain forms a folded conformation comprising a central five-stranded β-sheet

  • Secondary structure analysis suggests several β-strands alternating with α-helices

  • The N-terminal region (amino acids 51–90) may fold as a long helix connecting the ectodomain and transmembrane region

  • Contains two important surface loops: 170LGYSG174 and 125RRGTGDAW132, which constitute the A28-binding region

  • The C-terminal domain with the disulfide bridges localizes on the surface of the virion, likely interacting with host cell components during entry

How does H2 function in the viral entry process?

H2 is an essential component of the entry fusion complex (EFC) required for vaccinia virus penetration into host cells. Specifically:

  • H2 interacts with the A28 protein to form a subcomplex within the larger viral fusion machinery

  • Studies using recombinant viruses with regulated H2 expression (vH2i) show that virions lacking H2 (-H2) can bind to cells but their cores cannot penetrate into the cytoplasm

  • These -H2 virions are unable to mediate the formation of syncytia after low-pH treatment, indicating H2 is critical for the fusion event that allows viral cores to enter the cytoplasm

  • Despite being unable to enter cells, -H2 virions appear morphologically normal and contain the same complement of major proteins as infectious +H2 virions

  • H2 functions specifically in the membrane fusion process rather than in viral morphogenesis or binding to host cells

What experimental approaches can effectively characterize H2 protein interactions with other viral components?

Several complementary approaches can be employed to study H2 protein interactions:

  • Coimmunoprecipitation (Co-IP):

    • Has successfully demonstrated the interaction between H2 and A28 proteins

    • Can identify additional binding partners within the entry fusion complex

  • Alanine-mutagenesis screening in transient complementation systems:

    • Systematically replace amino acids in H2 with alanine and test the ability of mutant proteins to restore function

    • Helps map functional domains and binding interfaces

  • Isothermal Titration Calorimetry (ITC):

    • Provides quantitative measurements of protein-protein interactions

    • Determines binding affinity, stoichiometry, and thermodynamic parameters

  • Mature virion (MV)-triggered membrane fusion assays:

    • Evaluate the impact of H2 mutations on viral fusion activity

    • Correlate molecular interactions with functional outcomes

  • Structural biology approaches:

    • X-ray crystallography has revealed the structure of the H2 ectodomain

    • Can be extended to study H2 in complex with binding partners

How can recombinant H2 protein be expressed and purified for structural and functional studies?

Based on published methodologies, recombinant H2 protein can be produced using the following approaches:

  • Bacterial expression system:

    • Clone the truncated ectodomain of H2 protein (tH2, containing amino acids 91–189) into an expression vector

    • The pET28a-Smt3-tH2 construct expresses vaccinia tH2 protein with a 10xHis-SUMO tag at its N-terminal region

    • Use the smt3/Ulp system for protein expression in Escherichia coli

  • Site-directed mutagenesis:

    • Generate H2 mutants using QuikChange Lightning Site-Directed Mutagenesis Kit

    • Confirm mutation accuracy by sequencing

  • Mammalian expression system:

    • For functional studies, codon-optimize the H2R gene for expression in mammalian cells

    • Clone into a mammalian expression vector such as pEF6

  • Purification strategy:

    • Use affinity chromatography with His-tag fusion proteins

    • Remove tags with specific proteases (e.g., SUMO protease)

    • Further purify using size exclusion chromatography

    • Verify protein purity by SDS-PAGE and western blotting

What are the critical residues in H2 protein that determine its function in viral entry?

Mutagenesis and functional studies have identified several critical regions in H2 protein:

  • A28-binding regions:

    • Loop region 170LGYSG174 is crucial for vaccinia virus infectivity and interaction with A28

    • Loop region 125RRGTGDAW132 also contributes to the A28-binding interface

  • N-terminal helical region:

    • Residues 64RIK66, 72W, and 83ESDRGR88, while not involved in A28 binding, are crucial for viral EFC formation and MV infectivity

    • This region is proximal to the transmembrane domain and may play a structural role in complex assembly

  • Four invariant cysteines:

    • Form two intramolecular disulfide bridges essential for proper protein folding and function

    • Highly conserved across all poxvirus family members

  • C-terminal domain:

    • Contains residues that localize to the virion surface

    • Critical for the fusion process during viral entry

How can one design a conditional lethal mutant to study H2 protein function?

A conditional lethal mutant system for H2 can be designed using an IPTG-inducible expression system, as demonstrated with the vH2i virus:

  • Components of the inducible system:

    • The E. coli lac repressor gene under control of a vaccinia virus dual early-late promoter

    • Bacteriophage T7 RNA polymerase regulated by a vaccinia virus late promoter and lac operator

    • H2R ORF placed under control of the T7 promoter and lac operator

  • Two-level regulation mechanism:

    • In the absence of IPTG (inducer), the lac repressor inhibits both T7 polymerase expression and H2R transcription

    • This dual inhibition ensures stringent repression of H2 protein synthesis

  • Implementation procedure:

    • Replace the native H2R promoter with the inducible system via homologous recombination

    • Co-insert an EGFP expression cassette for identification of recombinant virus

    • Plaque purify and propagate the virus in the presence of IPTG

  • Experimental controls:

    • Confirm regulation by western blotting for H2 protein in the presence/absence of IPTG

    • Verify the phenotype by plaque formation assays and electron microscopy

This system allows researchers to study the consequences of H2 loss while maintaining normal virus propagation in the presence of inducer.

What assays can be employed to evaluate the fusion activity of recombinant H2 mutants?

Several complementary assays can assess the fusion activity of H2 mutants:

  • Low-pH-triggered cell-cell fusion assay (fusion from within):

    • Infect cells with recombinant virus expressing H2 mutants

    • Treat infected cells briefly with low pH buffer (typically pH 4.7-5.0)

    • Monitor syncytia formation (multinucleated cells) by microscopy

    • Quantify fusion by counting nuclei in syncytia

  • Fusion from without assay:

    • Adsorb purified virions to cells at 4°C for 1 hour

    • Expose cells briefly to low pH at 37°C

    • Incubate with regular medium in the presence of cycloheximide

    • Examine syncytia formation by microscopy

  • Core penetration assay:

    • Monitor the entry of viral cores into the cytoplasm

    • Use electron microscopy or fluorescence techniques to track core release

    • Compare wild-type and mutant viruses

  • Virus spread assay:

    • Observe plaque formation in the presence of H2 mutants

    • Measure plaque size as an indicator of cell-to-cell spread

    • Evaluate the ability of the virus to form actin tails

  • Virion infectivity measurements:

    • Determine specific infectivity (PFU/particle) of purified virions

    • The search results show that -H2 virions had approximately 100-fold lower infectivity than +H2 virions

How can researchers quantitatively measure the interaction between H2 and A28 proteins?

Based on published methodologies, several techniques can quantitatively assess H2-A28 interactions:

  • Isothermal Titration Calorimetry (ITC):

    • Directly measures the heat released or absorbed during binding

    • Provides binding affinity (Kd), stoichiometry, and thermodynamic parameters

    • Requires purified proteins in solution

  • Coimmunoprecipitation with quantitative analysis:

    • Perform Co-IP using antibodies against H2 or A28

    • Quantify co-precipitated proteins by western blotting

    • Compare wild-type and mutant H2 proteins to identify critical binding regions

  • Alanine-mutagenesis screening:

    • Systematically replace amino acids in H2 with alanine

    • Test each mutant for A28 binding and correlate with functional outcomes

    • This approach identified two loop regions (170LGYSG174 and 125RRGTGDAW132) as crucial for A28 interaction

  • MV-triggered membrane fusion assays:

    • Functional assay that correlates binding with biological activity

    • Can determine whether mutations that disrupt binding also impair fusion function

  • Surface Plasmon Resonance (SPR):

    • Measures real-time binding kinetics and affinity

    • Can detect conformational changes upon binding

    • Useful for comparing different H2 mutants

How do researchers distinguish between defects in virus assembly versus entry when analyzing H2 mutants?

Distinguishing between assembly and entry defects requires a systematic analysis approach:

  • Electron microscopy examination:

    • Compare virion morphology of mutant and wild-type viruses

    • The search results show that -H2 and +H2 virions were indistinguishable by electron microscopy, indicating normal assembly

  • Virion protein composition analysis:

    • Analyze purified virions by SDS-PAGE and protein staining

    • -H2 and +H2 virions contained the same complement of major proteins, confirming normal assembly

  • Assessment of virion production stages:

    • Examine formation of immature virions (IV), intracellular mature virions (IMV), and cell-associated enveloped virions (CEV)

    • Under nonpermissive conditions, all stages of virus morphogenesis appeared normal with H2-deficient virus

  • Actin tail formation:

    • Visualize actin tails associated with virions using fluorescence microscopy

    • CEV were present at the tips of actin-containing microvilli in both +H2 and -H2 conditions

  • Cell binding assays:

    • Determine whether virions can attach to host cells

    • -H2 virions bound to cells but cores did not penetrate the cytoplasm

  • Syncytia formation after low-pH treatment:

    • Test the ability to induce cell-cell fusion

    • -H2 virions were unable to mediate syncytia formation, indicating a specific entry defect

  • Infectivity measurements:

    • Quantify infectious virus production

    • -H2 virions had approximately 100-fold lower specific infectivity than +H2 virions

What controls should be included when analyzing the effects of H2 mutations on virus infectivity?

Proper experimental controls are essential for accurate interpretation of H2 mutation effects:

Control TypeDescriptionPurpose
Wild-type H2Unmodified H2 protein expressionPositive control establishing baseline infectivity
No H2 expressionComplete absence of H2 (e.g., vH2i without IPTG)Negative control demonstrating the H2-null phenotype
Inducer titrationVarious IPTG concentrations with vH2iDetermines threshold levels of H2 required for function
Known functional mutationsPreviously characterized point mutationsReference points for comparative analysis
A28-deficient virusVirus lacking the interaction partner of H2Comparison control for similar entry defects
A27-deficient virusVirus lacking another surface proteinDifferential control (A27 mutants can still enter and cause syncytia)
Protein expression verificationWestern blotting for H2 in virionsConfirms proper expression and incorporation
Virus purification controlsMatched particle counts by OD260Ensures equivalent particle numbers in assays

These controls ensure that observed phenotypes are specifically attributed to H2 mutations rather than experimental artifacts or secondary effects.

How can contradictions in the literature regarding H2 protein function be reconciled?

When faced with contradictory findings about H2 function, researchers can use these strategies:

  • Comparative experimental systems analysis:

    • Different methodologies (conditional mutants, direct gene deletion, or point mutations) may yield varying results

    • For example, the search results reveal an apparent contradiction regarding the role of A27 protein in fusion: while previously considered essential, virions lacking A27 could still penetrate cells and induce syncytia, unlike H2-deficient virions

    • This was reconciled by recognizing that H2 and A28 are specifically required for entry, while A27 may have a different or redundant function

  • Structural-functional correlation:

    • The crystal structure of H2 ectodomain provides a framework for understanding functional effects

    • Map contradictory findings onto the structure to identify potential explanations

    • Different mutations might affect distinct functional properties while preserving others

  • Temporal and contextual analysis:

    • Consider the stage of viral life cycle being examined

    • H2 might have different functions depending on its interactions with other viral proteins

    • The search results demonstrate that H2 interacts with A28 to form a functional complex

  • Methodological differences:

    • Variation in cell types, virus strains, and assay conditions can affect outcomes

    • Standardizing experimental conditions can help resolve discrepancies

  • Integration of multiple techniques:

    • Combine structural, biochemical, genetic, and cell biological approaches

    • The most comprehensive understanding comes from integrating data from different methodologies

    • For example, the search results show how crystal structure determination, mutagenesis, and functional assays together identified key regions of H2 involved in A28 binding and fusion

What are the most promising approaches for targeting H2 protein in antiviral development?

The essential role of H2 in viral entry makes it an attractive target for antiviral development:

  • Structure-based drug design:

    • The crystal structure of H2 ectodomain provides a template for rational drug design

    • Focus on the A28-binding regions (170LGYSG174 and 125RRGTGDAW132) as potential binding sites for inhibitors

    • Design peptides or small molecules that mimic these interaction surfaces

  • Disruption of the H2-A28 interaction:

    • Target the protein-protein interface with specific inhibitors

    • Screen compound libraries for molecules that interfere with this interaction

    • Validate hits using coimmunoprecipitation and functional assays

  • Exploitation of the N-terminal helical region:

    • The region containing residues 64RIK66, 72W, and 83ESDRGR88 is crucial for EFC formation

    • Design inhibitors that disrupt the structural integrity of this region

  • Broad-spectrum poxvirus inhibitors:

    • The high conservation of H2 across poxviruses suggests that inhibitors could have broad-spectrum activity

    • Target the most conserved regions of the protein

  • Combination approaches:

    • Design strategies that simultaneously target multiple components of the entry fusion complex

    • This could reduce the likelihood of resistance development

How might advanced imaging techniques enhance our understanding of H2 function during viral entry?

Advanced imaging approaches could provide new insights into H2 function:

  • Super-resolution microscopy:

    • Track the localization and dynamics of H2 protein during the entry process

    • Visualize the formation and rearrangement of the entry fusion complex

    • Compare wild-type and mutant H2 proteins to identify functional differences

  • Correlative light and electron microscopy (CLEM):

    • Combine the specificity of fluorescence labeling with the ultrastructural detail of electron microscopy

    • Visualize H2 in the context of membrane fusion events

    • Track the fate of viral cores during entry

  • Single-particle cryo-electron microscopy:

    • Determine the structure of the complete entry fusion complex

    • Visualize conformational changes that occur during the fusion process

    • Compare the structure in different functional states

  • Live-cell imaging:

    • Monitor the dynamics of H2 during virus entry in real-time

    • Use fluorescently tagged H2 variants to track its movement and interactions

    • Correlate H2 dynamics with membrane fusion events

  • Atomic force microscopy:

    • Examine the topography of the virion surface and the distribution of H2 protein

    • Measure the mechanical properties of membranes during fusion

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.