Recombinant Vaccinia virus Protein H2 (VACWR100)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Vaccinia Virus Protein H2 (VACWR100)

The vaccinia virus H2R gene, also known as VACWR100 in the Western Reserve (WR) strain, is highly conserved among all sequenced members of the poxvirus family . The H2 protein is an essential component for vaccinia virus entry and is likely part of a fusion complex . It encodes a 21.5 kDa protein that has a predicted transmembrane domain and four invariant cysteines .

Structure and Conservation

All poxvirus H2 orthologs contain a predicted transmembrane domain, located 30 amino acids from the N terminus, and four conserved cysteines . Secondary structure analysis suggested several β-strands alternating with α-helices . The nucleotide sequence upstream of the H2R gene has characteristics of a typical late promoter . No significant sequence similarity between H2 and any nonpoxvirus protein has been detected based on iterative database searches with the PSI-BLAST program .

Interaction with Other Proteins

Coimmunoprecipitation experiments indicated an interaction between H2 and A28 proteins . H2 and A28 are the only proteins presently known to be specifically required for vaccinia virus entry and are likely components of a fusion complex .

Role in Virus Entry

Virions lacking H2 bind to cells, but their cores do not penetrate into the cytoplasm . Exogenously added -H2 virions were unable to mediate the formation of syncytia after low-pH treatment .

Impact of H2 Mutations on Viral Infectivity

Mutations in the N-terminal α-helix (amino acids 55–90) of the H2 protein interfere with EFC formation and virus infectivity without affecting its binding to A28 .

Recombinant Vaccinia Virus for Protein Expression

Recombinant vaccinia virus is widely used to express foreign genes from different origins . For example, a vaccinia virus recombinant expressing the astrovirus 87-kDa structural polyprotein results in the formation of virus-like particles .

Tables

FeatureDescription
Gene NameH2R (VACWR100)
Protein Size21.5 kDa
ConservationHighly conserved in all sequenced poxviruses
Transmembrane DomainPresent, located 30 amino acids from the N terminus
CysteinesFour invariant cysteines
Essential RoleReproduction and plaque formation
InteractionInteracts with A28 protein
FunctionRequired for vaccinia virus entry

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VACWR100; H2R; Protein H2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR100
Target Protein Sequence
MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELT RYMRIKNTVNDWKSLTDSKTKLESDRGRLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYL PQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPH WCSDFSNME
Uniprot No.

Target Background

Function
The envelope protein is part of the entry-fusion complex, responsible for viral membrane fusion with the host cell membrane during viral entry. It also likely plays a role in cell-cell fusion (syncytium formation).
Database Links

KEGG: vg:3707556

Protein Families
Poxviridae H2 family
Subcellular Location
Virion membrane; Single-pass type III membrane protein.

Q&A

What is the basic structure of the Vaccinia virus H2 protein?

The H2 protein (encoded by the H2R gene, VACWR100) is a 21.5-kDa protein conserved across all sequenced poxviruses. The crystal structure of the H2 ectodomain reveals a folded conformation comprising a central five-stranded β-sheet and three cladding α-helices. The protein contains a predicted transmembrane domain located approximately 30 amino acids from the N-terminus, and four conserved cysteines that form two stabilizing disulfide bonds: C102–C148 and C162–C182. These disulfide bonds anchor α-helix 1 onto β-sheet 1 and tether helix α3 to the β5-α2 loop, respectively. The structure is further stabilized by hydrophobic cores containing nonpolar amino acids such as V103, F147, I160, and W181 .

How is H2 protein conserved across the poxvirus family?

H2 protein is highly conserved in all sequenced members of the poxvirus family. Iterative database searches using PSI-BLAST reveal no significant sequence similarity between H2 and any non-poxvirus protein, suggesting a poxvirus-specific role. All poxvirus H2 orthologs contain a predicted transmembrane domain and four invariant cysteines. Secondary structure analysis suggests several β-strands alternating with α-helices, and the nucleotide sequence upstream of the H2R gene displays characteristics of a typical late promoter .

What is the essential function of H2 protein in the vaccinia virus life cycle?

H2 protein is specifically required for vaccinia virus entry into host cells. Studies using recombinant vaccinia viruses with regulated H2 expression show that virions lacking H2 (-H2) can bind to cells but cannot penetrate into the cytoplasm. Furthermore, these virions cannot mediate syncytia formation after low-pH treatment. This indicates that H2 is essential for the membrane fusion step of virus entry. H2 interacts with another viral protein, A28, and both are components of a fusion complex required for virus entry .

How was the crystal structure of the H2 ectodomain determined?

The crystallization of the H2 ectodomain was achieved using X-ray diffraction techniques. The crystal belonged to space group C2221 with unit cell dimensions a=46.7Å, b=60.4Å, c=131.6Å, and angles α=β=γ=90°. Data was collected to a resolution of 1.75Å. The structure was refined to R-work and R-free values of 16.9% and 20.3%, respectively. The final structure had excellent geometry with 95.7% of residues in the most favored regions of the Ramachandran plot and no outliers . The crystal contained two protein molecules in the asymmetric unit with virtually identical three-dimensional structures (RMSD of 0.35Å for 81 pairs of Cα atoms).

Data collection parametersValues
Wavelength (Å)1.00000
Space groupC2221
Unit cell a, b, c (Å)46.7, 60.4, 131.6
α, β, γ (°)90, 90, 90
Resolution (Å)20–1.75 (1.81–1.75)
Unique reflections19019 (1895)
Redundancy3.6 (3.6)
Completeness (%)98.9 (100)
I / σ(I)34.2 (3.3)
R merge (%)5.6 (42.7)

What specific domains of the H2 protein are critical for its interaction with A28?

Structural and functional analyses have identified specific regions of the H2 protein that are crucial for its interaction with A28. Two surface loops containing residues 170LGYSG174 and 125RRGTGDAW132 constitute a broad A28-binding region. These regions were identified through a series of mutational, biochemical, and molecular analyses . In addition, the N-terminal helical region proximal to the membrane, encompassing residues 64RIK66, 72W, and 83ESDRGR88, though not directly involved in A28 binding, is important for viral entry fusion complex (EFC) formation and MV infectivity .

How does the H2-A28 complex contribute to viral membrane fusion?

The H2-A28 complex is a critical component of the vaccinia virus entry fusion complex (EFC). Co-immunoprecipitation experiments have demonstrated a direct interaction between H2 and A28, and both proteins are specifically required for vaccinia virus entry. The complex is likely the core component of a larger fusion machinery that mediates membrane fusion during virus entry. Studies using 2D HSQC NMR spectroscopy have shown that soluble forms of A28 and H2 proteins bind in vitro with intermediate affinity in the μM range and with a 1:1 stoichiometry . Mutations in either protein that disrupt this interaction result in virions that can bind to cells but cannot penetrate the cytoplasm, indicating the essential role of the H2-A28 complex in membrane fusion .

How can recombinant vaccinia viruses with regulated H2 expression be constructed?

To generate recombinant vaccinia viruses with regulated H2 expression (vH2i), researchers have used a system derived from vT7lacOI, which contains an isopropyl-β-d-thiogalactoside (IPTG)-inducible bacteriophage T7 RNA polymerase gene and the Escherichia coli lac repressor gene inserted into the nonessential thymidine kinase locus. The promoter of the H2R gene is replaced with an E. coli lac operator-regulated T7 promoter by homologous recombination using a PCR product that also contains the open reading frame encoding enhanced green fluorescent protein (EGFP) regulated by the vaccinia virus synthetic early-late promoter. Plaques containing recombinant virus are identified by EGFP expression using an inverted fluorescence microscope and clonally purified in the presence of IPTG . This system allows for stringent regulation of H2 expression, enabling researchers to study the effects of H2 deficiency on virus replication and cell entry.

What methods are used to assess the interaction between H2 and A28 proteins?

Several complementary techniques have been employed to study the interaction between H2 and A28 proteins:

  • Co-immunoprecipitation (co-IP): Using anti-A28 antibodies to pull down protein complexes from infected cells, followed by Western blotting to detect H2 and other potential interacting partners .

  • 2D 1H-15N heteronuclear single quantum coherence (HSQC) NMR spectroscopy: This technique uses 15N-isotope-labeled forms of A28 protein (e.g., sA28, residues 56-146) and soluble forms of H2 protein (e.g., sH2, residues 91-189) to detect direct binding and measure binding affinity in vitro .

  • Isothermal titration calorimetry (ITC): Used to determine binding affinity and stoichiometry of purified A28 and H2 protein variants, providing quantitative KD measurements .

  • Mutational analysis: Systematic alanine mutagenesis of conserved residues in both proteins, followed by functional assays to identify critical residues for protein-protein interaction .

How can the membrane fusion activity of H2 mutants be experimentally assessed?

The membrane fusion activity of H2 mutants can be assessed using the following methods:

  • Low-pH syncytia formation assay: Cells infected with wild-type or mutant viruses are briefly treated with acidic buffer (pH ~5.0) followed by incubation in normal medium. Formation of multinucleated syncytia is then quantified by microscopy .

  • Virus penetration assay: Purified virions (with or without H2 mutations) are bound to cells at 4°C, followed by a temperature shift to 37°C to allow penetration. Uncoated cores in the cytoplasm are then detected by immunofluorescence using anti-core antibodies .

  • Trans-complementation assays: H2-deficient viruses are complemented with wild-type or mutant H2 proteins expressed from plasmids, and virus growth and spread are measured to assess functional restoration .

  • Correlation analysis: Quantitative comparison between viral yield and MV-triggered membrane fusion for different H2 mutants to establish structure-function relationships .

How does the protein composition of H2-deficient virions compare to wild-type virions?

Purified -H2 and +H2 virions (from cells infected in the absence or presence of inducer, respectively) are indistinguishable in microscopic appearance and contain the same complement of major proteins. The only significant difference is that only +H2 virions are infectious. This indicates that H2 is not required for virus assembly or morphogenesis but is specifically needed for the entry process . Studies using comprehensive proteomic analyses have identified approximately 66 viral proteins as constitutive components of the mature virion (MV) particles, with H2 being one of these essential components .

What proteomic techniques are used to identify components of the vaccinia virus entry fusion complex?

Several proteomic approaches have been used to characterize the vaccinia virus entry fusion complex:

  • Mass spectrometry: Purified virions are subjected to tryptic digestion followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify component proteins .

  • Sucrose and tartrate gradient centrifugation: These techniques are used to purify different forms of viral particles for proteomic analysis. For example, viral suspensions can be layered on a double sucrose cushion of 36%–72% and centrifuged at 100,000g, with the visible band of virion collected at the interface .

  • Differential purification methods: A series of purification steps including centrifugation, DNase and trypsin treatments, sonication, and gradient separation to obtain highly purified virions for proteomic analysis .

  • Analytical methodology for distinguishing packaged proteins from contaminants: This involves comparing protein abundance across different purification methods and applying statistical criteria to identify true virion components versus contaminants .

How is the expression of the H2R gene regulated during vaccinia virus infection?

The H2R gene expression follows the temporal cascade of vaccinia virus gene expression. The nucleotide sequence upstream of the H2R gene has characteristics of a typical late promoter, suggesting that H2 is expressed during the late phase of infection . This is consistent with its role in virion assembly and entry. Genome-wide transcriptome analysis using tiling arrays has provided insights into the temporal regulation of all vaccinia virus genes, including H2R .

What approaches can be used to monitor H2 gene expression during infection?

Several techniques can be employed to monitor H2 gene expression:

  • Tiling arrays: Genome tiling arrays containing 25-mer DNA probes interrogating both strands of the VACV genome at a 4-nt resolution can be used to measure transcription profiles over time .

  • Quantitative PCR (Q-PCR): This technique can quantify H2 mRNA levels relative to a reference gene (such as 18S rRNA) at different time points post-infection .

  • Northern blotting: This technique can detect H2-specific transcripts in infected cells.

  • RNA-seq: High-throughput sequencing of viral transcripts provides comprehensive data on expression levels and potential alternative transcripts.

  • Western blotting: Using H2-specific antibodies to detect protein expression levels at different time points.

For accurate gene expression analysis, it's important to normalize data and use appropriate controls. For example, the tiling array approach includes background subtraction using synthetic and Arabidopsis thaliana probes as empirical estimators, followed by quantile normalization to enable direct comparison of signal intensities across different arrays .

How can H2 protein structure inform the design of antiviral compounds?

The atomic structure of the H2 protein provides valuable insights for structure-based drug design. Potential approaches include:

  • Targeting the H2-A28 interaction interface: The identified surface loops containing residues 170LGYSG174 and 125RRGTGDAW132 that constitute the A28-binding region represent potential targets for small molecules that could disrupt this essential interaction .

  • Exploiting the disulfide bonds: The disulfide bonds (C102–C148 and C162–C182) that stabilize the H2 structure could be targeted by compounds that disrupt disulfide formation or exchange .

  • Structure-based virtual screening: Using the H2 crystal structure to perform in silico screening of compound libraries to identify potential binders that could interfere with H2 function.

  • Peptidomimetics: Designing peptides or peptidomimetics that mimic critical regions of A28 involved in H2 binding to competitively inhibit the formation of the fusion complex.

  • Rational modification of H2: Engineering recombinant H2 proteins with specific mutations that could act as dominant-negative inhibitors of viral fusion.

What are the implications of H2 protein conservation for developing broad-spectrum poxvirus vaccines or therapeutics?

The high conservation of H2 across all sequenced poxviruses makes it an attractive target for broad-spectrum interventions:

  • Cross-reactive antibodies: Antibodies targeting conserved epitopes in H2 might neutralize multiple poxviruses by preventing viral entry.

  • Conserved T-cell epitopes: Identifying conserved T-cell epitopes within H2 could guide the development of vaccines that elicit cross-protective cellular immunity.

  • Universal drug targets: The conserved structural features and functional domains of H2 could serve as targets for antiviral drugs effective against multiple poxviruses.

  • Attenuated vaccine platforms: Engineered H2 mutations that compromise fusion efficiency without abolishing virus replication could form the basis of attenuated vaccine strains.

  • Surrogate model systems: Due to H2 conservation, findings from vaccinia virus models may be applicable to other poxviruses, including those that cause human disease.

How do researchers reconcile differing results regarding the role of A27 vs. H2/A28 in membrane fusion?

  • Distinct roles in fusion: A27 may play a supporting or regulatory role in fusion rather than being directly involved in the fusion mechanism, while H2 and A28 are essential components of the fusion apparatus.

  • Methodological differences: Different experimental approaches (e.g., temperature, pH conditions, cell types) might influence the relative contributions of these proteins to observed fusion events.

  • Context-dependent functions: A27 might be more important for fusion in certain cell types or entry pathways, while H2/A28 are universally required.

  • Multi-step fusion process: A27, H2, and A28 might function at different stages of a complex fusion cascade, with some steps being bypassed under certain experimental conditions.

  • Compensatory mechanisms: Other viral proteins might partially compensate for A27 deficiency but not for H2/A28 deficiency.

What technical challenges exist in studying the structure and function of integral membrane proteins like H2?

Integral membrane proteins like H2 present several technical challenges:

  • Protein expression and purification: The transmembrane domain makes H2 difficult to express and purify in sufficient quantities for structural studies. This is typically addressed by working with soluble ectodomains (e.g., sH2, residues 91-189) .

  • Crystallization difficulties: Membrane proteins often resist crystallization due to their hydrophobic regions. Researchers have overcome this by using truncated constructs lacking the transmembrane domain .

  • Native conformation maintenance: Ensuring that soluble constructs maintain native-like conformations and functions is challenging. Complementary techniques like NMR and functional assays are needed to validate structural data .

  • Complex formation requirements: H2 functions as part of a multi-protein complex, making it difficult to study in isolation. Techniques like co-immunoprecipitation and co-expression systems help address this challenge .

  • Membrane environment reconstitution: The lipid environment can significantly influence membrane protein structure and function. Liposome-based assays or nanodiscs may provide more physiologically relevant contexts for studying H2 function.

What emerging technologies might advance our understanding of H2 protein function?

Several cutting-edge technologies hold promise for further elucidating H2 protein function:

  • Cryo-electron microscopy (cryo-EM): This technique could potentially reveal the structure of the entire entry fusion complex, including H2, A28, and other components, in a near-native state.

  • Single-molecule techniques: Methods such as single-molecule FRET could provide insights into conformational changes in H2 during the fusion process.

  • Advanced computational modeling: Enhanced molecular dynamics simulations combined with machine learning approaches could help predict how H2 contributes to membrane fusion mechanics.

  • In situ structural techniques: Methods like cryo-electron tomography could visualize H2 and the fusion complex in the context of virions and cellular membranes.

  • Genome editing tools: CRISPR-Cas9 could be used to create subtle mutations in the H2 gene to further dissect its function in the viral life cycle.

How might comparative analysis of H2 across different poxviruses yield new insights?

Comparative analysis of H2 across different poxviruses could reveal:

  • Evolutionary adaptations: Identifying sequence variations that correlate with host range or tissue tropism could reveal how H2 contributes to viral adaptation.

  • Functional conservation: Determining which structural and functional features are invariant across diverse poxviruses would highlight the most critical aspects of H2 function.

  • Species-specific interactions: Comparing H2-A28 interactions across different poxviruses might reveal species-specific adaptations in the fusion machinery.

  • Cross-complementation studies: Testing whether H2 from one poxvirus can functionally replace H2 in another could reveal host-specific constraints.

  • Structure-function correlation: Mapping sequence diversity onto the H2 structural model could identify regions under selective pressure versus those that are structurally constrained.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.