Recombinant Vaccinia virus Protein I5 (I5L)

Shipped with Ice Packs

In Stock

Cat. No.

BT2038321

Source

in vitro E.coli expression system

Synonyms

I5L; Protein I5

Quick Inquiry

Description

Overview of Recombinant Vaccinia Virus Protein I5 (I5L)

Recombinant Vaccinia Virus Protein I5 (I5L) is a 78–79 amino acid (aa) protein encoded by the I5L open reading frame (ORF) of vaccinia virus. It is conserved across all sequenced chordopoxviruses and classified as a structural protein localized to the virion membrane . Recombinant forms, such as epitope-tagged variants (e.g., V5 or HA tags), enable functional and localization studies .

Key Features:

Property	Value/Description
Molecular Weight	~9 kDa
Hydrophobic Domains	Two transmembrane domains (N- and C-terminal)
Post-Translational Modifications	No phosphorylation detected in vivo
Virion Localization	Membranes of immature and mature virions
Surface Exposure	C-terminus exposed on intact virions

Conservation: The I5L ORF is fully conserved among orthopoxviruses, with >90% aa identity across species .
Membrane Association: Detergent extraction experiments (NP-40/DTT) confirm I5 is an integral membrane protein .

Temporal Regulation:

Expressed as a post-replicative (late) gene, dependent on viral DNA replication .
Localizes to viral factories and assembling virions, as shown by immunoelectron microscopy .

Subcellular Distribution:

Immunogold Labeling: Tagged I5 (V5/HA) localizes to membranes of:
- Crescents (early morphogenesis intermediates)
- Immature virions (IV)
- Mature virions (MV) .
No association with cellular organelles (e.g., ER, Golgi) .

Key Recombinant Constructs:

vI5V5: Endogenous I5 tagged with V5 epitope .
vΔindI5V5: TET-regulated I5 expression with deletion of endogenous I5L .
vΔI5: I5L deletion mutant .

In Vitro Findings:

Parameter	Result
Viral Yield (BSC40 Cells)	No difference vs. wild-type (WT)
Plaque Morphology	Normal size and appearance
Proteolytic Core Processing	Unaffected by I5 repression
Replication in Primary Cells	Normal in human fibroblasts and keratinocytes .

Mouse Intranasal Challenge Studies:

Virus	Dose (PFU)	Survival Rate	Weight Loss Severity
vI5Rev (Control)	1 × 10⁵	0%	Severe
vI5Stop (Mutant)	1 × 10⁵	90%	Moderate

Key Observations:
- Attenuation: I5 frameshift mutants (vI5Stop) show reduced lethality and faster viral clearance .
- Pathology: Mutants cause less lung inflammation and earlier resolution of lesions .

Proposed Biological Role

I5 contributes to virulence by:

Stabilizing virions in extracellular environments.
Mediating interactions with host ligands during entry or spread.
Counteracting immune defenses in respiratory tract .

Product Specs

Form

Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will prepare the product according to your request.

Lead Time

Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.

Shelf Life

Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.

Synonyms

I5L; Protein I5

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-79

Protein Length

full length protein

Species

Vaccinia virus (strain Copenhagen) (VACV)

Target Names

I5L

Target Protein Sequence

MVDAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIY IPGTIILYATYVKSLLMKS

Uniprot No.

P20500

Target Background

Function

Envelope protein.

Protein Families

Chordopoxvirinae I5 family

Subcellular Location

Virion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Vaccinia virus Protein I5 (I5L)

Description

Overview of Recombinant Vaccinia Virus Protein I5 (I5L)

Key Features:

Temporal Regulation:

Subcellular Distribution:

Key Recombinant Constructs:

In Vitro Findings:

Mouse Intranasal Challenge Studies:

Proposed Biological Role

Product Specs

Target Background

Quick Inquiry

Category

Service