Recombinant Vaccinia virus Protein I5 (VACWR074)

Shipped with Ice Packs
In Stock

Description

Functional Roles

Virion incorporation:

  • Localizes to virion membranes with C-terminus exposed on the surface .

  • Released upon NP40 treatment, confirming membrane association .

Biological significance:

  • Non-essential for replication in BSC40 cells and human fibroblasts .

  • Plaque morphology and thermostability unaffected by deletion .

  • Contributes to pathogenesis in murine models (reduced virulence in ΔI5 mutants) .

Research Findings

Key studies using recombinant I5 proteins:

Study DesignMethodologiesOutcomesCitation
I5 deletion analysisΔI5 virus construction in vaccinia WR strainNo yield reduction in BSC40/HFF cells
Structural localizationImmunoelectron microscopyC-terminal epitope accessible on virions
Pathogenesis assayMurine infection modelsAttenuated virulence in ΔI5 mutants
Expression profilingImmunoblotting with V5-tagged I5Late-phase expression kinetics

Applications in Research

  • Virion structure studies: Membrane protein orientation analysis

  • Pathogenesis models: Comparative studies using ΔI5 mutants

  • Immunological tools: Antigen for antibody production (SUMO/His tags enable purification)

  • Protein interaction studies: Hydrophobicity suggests potential host membrane interactions

Product Specs

Buffer
The default storage buffer for liquid delivery form is Tris/PBS-based buffer, containing 5%-50% glycerol.

Note: If you have specific requirements regarding the glycerol content, please specify them in your order notes.
Form
The delivery form is available as either Liquid or Lyophilized powder.

Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
VACWR074; I5L; Protein I5; Protein VP13K
Datasheet & Coa
Please contact us to get it.
Expression Region
2-79aa
Mol. Weight
24.6kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
others
Source
in vitro E.coli expression system
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR074
Target Protein Sequence
VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Envelope protein.
Gene References Into Functions
  1. Results suggest that I5 is involved in an aspect of host defense that is evolutionarily conserved, although a role in cell tropism should also be considered. PMID: 18701595
  2. I5 is dispensable for replication in tissue culture. PMID: 19077320
Database Links

KEGG: vg:3707607

Protein Families
Chordopoxvirinae I5 family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Note=Probably localizes to the membrane of mature virions (MV).

Q&A

Where is protein I5 localized within infected cells and virions?

Immunofluorescence microscopy studies have shown that I5 protein displays a punctate distribution that overlaps with viral replication factories and extends throughout the cytoplasm. The protein is not restricted to specific subcellular compartments such as the ER, Golgi, or plasma membrane .

Regarding virion association, I5 is associated with:

  • Membrane components of assembling virions (crescents)

  • Immature virions

  • Mature virions

Within the mature virion, I5 is specifically encapsidated in the virion membrane, and fractionation studies show it is released into the soluble phase after treatment with NP40 alone, indicating it behaves as a typical membrane protein .

Is protein I5 essential for viral replication?

Despite being conserved across orthopoxviruses, experimental evidence demonstrates that I5 is dispensable for viral replication in tissue culture. Studies using both inducible I5 expression systems (vΔindI5V5) and I5 deletion mutants (vΔI5) have shown:

  • Repression of I5 expression has no impact on viral yield in BSC40 cells or human diploid fibroblasts

  • I5-deleted viruses can be readily isolated and propagated

  • Plaque size is unaffected by the absence of I5

  • Virion thermostability is not compromised when I5 is absent

What expression systems are optimal for recombinant production of I5 protein?

For recombinant expression of Vaccinia virus I5 protein, E. coli systems have been successfully employed. When designing expression constructs, researchers should consider:

Expression SystemTag PositionProtein LengthExpression EfficiencyNotes
E. coliN-terminal His tagFull length (2-79aa)GoodThe hydrophobic nature may require optimization
E. coliHis-SUMO tagFull lengthEnhanced solubilitySUMO fusion improves folding and solubility
Mammalian cellsC-terminal tag (e.g., V5)Full lengthNative foldingUseful for functional studies

When expressing in bacterial systems, it's advisable to:

  • Use low-temperature induction (16-18°C)

  • Include mild detergents in lysis and purification buffers

  • Consider fusion partners that enhance solubility (e.g., SUMO, MBP)

  • Purify under native conditions when possible

How should researchers design experiments to study I5 protein topology in virions?

To investigate I5 protein topology within virions, researchers have employed several complementary approaches:

  • Virion fractionation studies:

    • Treat purified virions with NP40 (membrane disruption) with or without DTT (disulfide reduction)

    • Separate soluble and pellet fractions by centrifugation

    • Analyze fractions by immunoblotting

    • I5 is released into the soluble phase after NP40 treatment alone, indicating its membrane association

  • Immunoelectron microscopy:

    • Label intact virions with antibodies against tagged I5 (e.g., V5 epitope)

    • Visualization with gold-conjugated secondary antibodies

    • This approach revealed that the C-terminus of I5 is exposed on the virion surface

  • Protease protection assays:

    • Treat intact virions with proteases (trypsin, chymotrypsin, proteinase K)

    • Analyze patterns of proteolysis by immunoblotting

    • Differential sensitivity to proteases provides insights into exposed regions

    • For I5, proteinase K can partially access the C-terminus but not other regions in intact virions

When designing such experiments, researchers should include appropriate controls:

  • Wild-type virus (without epitope tags) for specificity

  • Known proteins with established topology (e.g., D8 for surface exposure)

  • Multiple proteases with different cleavage specificities

What methodologies are effective for studying I5's role in viral morphogenesis?

To investigate I5's potential roles in viral morphogenesis, researchers can employ the following experimental approaches:

  • Conditional expression systems:

    • TET-regulated expression constructs (e.g., vΔindI5V5)

    • Allow tight control of expression levels and timing

    • Compare viral replication metrics under permissive and non-permissive conditions

  • Deletion mutants:

    • Complete gene knockout (e.g., vΔI5)

    • Allow assessment of phenotypes in the complete absence of the protein

    • Useful for complementation studies

  • Electron microscopy:

    • Ultrastructural analysis of virion morphogenesis in the presence/absence of I5

    • Immunogold labeling to track I5 localization during assembly

    • Quantification of morphological intermediates

  • Live-cell imaging:

    • Fluorescently tagged I5 constructs

    • Real-time visualization of protein trafficking and virion assembly

    • FRAP (Fluorescence Recovery After Photobleaching) to assess dynamics

Despite I5 being non-essential in tissue culture, researchers should examine:

  • Subtle differences in replication kinetics

  • Efficiency of virion assembly

  • Virion stability under various stress conditions

  • Differences in cell-to-cell spread

How does I5 contribute to vaccinia virus pathogenesis in vivo?

While I5 is dispensable for replication in tissue culture, evidence suggests it plays an important role in viral pathogenesis in animal models. To investigate this aspect, researchers should consider:

  • Animal infection models:

    • Compare wild-type and I5-deleted viruses in murine models

    • Assess parameters including:

      • Viral loads in target organs

      • Lesion development and progression

      • Spread between tissues

      • Immune response profiles

      • Survival rates at varying challenge doses

  • Cell type-specific effects:

    • Test replication in specialized cell types not routinely used in tissue culture:

      • Primary immune cells (dendritic cells, macrophages)

      • Tissue-specific primary cells (e.g., epithelial cells, neurons)

      • Polarized cell layers that mimic tissue barriers

  • Host response modulation:

    • Comparative transcriptomics/proteomics in cells infected with wild-type vs. I5-deleted viruses

    • Analysis of cytokine/chemokine production

    • Effects on innate immune signaling pathways

The conserved nature of I5 across orthopoxviruses strongly suggests it serves an important function in the natural virus life cycle that may only become apparent in complex in vivo systems .

What is the molecular mechanism of I5's membrane association and topology?

Understanding the precise membrane topology of I5 requires sophisticated biophysical and biochemical approaches:

  • Structural analysis:

    • Membrane protein crystallography (challenging)

    • NMR studies of purified protein in membrane mimetics

    • Cryo-electron microscopy of virions or reconstituted membranes

  • Computational prediction and validation:

    • Hydrophobicity analysis indicates multiple potential membrane-interacting regions

    • Algorithms predict potential transmembrane domains

    • These predictions require experimental validation through:

      • Cysteine scanning mutagenesis

      • Site-directed fluorescence labeling

      • EPR spectroscopy

  • Systematic mutagenesis approaches:

    • Generate targeted mutations in hydrophobic domains

    • Assess effects on:

      • Membrane association

      • Virion incorporation

      • Protein stability and folding

      • Topology within the membrane

Current evidence indicates both termini of I5 are likely exposed on the virion surface, suggesting a hairpin-like insertion into the membrane .

How can researchers investigate potential interactions between I5 and other viral or host proteins?

To identify and characterize potential protein-protein interactions involving I5, researchers can employ several complementary techniques:

  • Affinity purification coupled with mass spectrometry:

    • Express epitope-tagged I5 in infected cells

    • Perform immunoprecipitation under different detergent conditions

    • Identify co-precipitating proteins by mass spectrometry

    • Validate potential interactions through reciprocal co-immunoprecipitation

  • Proximity labeling approaches:

    • Generate fusion proteins with BioID or APEX2

    • Allow biotinylation of proximal proteins in living cells

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach can identify transient or weak interactions

  • Genetic approaches:

    • Suppress-and-rescue experiments with I5 mutants

    • Synthetic genetic screens to identify functional relationships

    • Split-reporter assays (e.g., split-GFP, split-luciferase) for direct interaction detection

  • Structural studies:

    • Co-crystallization of I5 with binding partners

    • Hydrogen-deuterium exchange mass spectrometry

    • NMR-based interaction mapping

When interpreting interaction data, researchers should consider:

  • Distinguishing direct from indirect interactions

  • The timing of interactions during the viral lifecycle

  • The subcellular localization of potential interactions

  • The functional significance of identified interactions

What are the key challenges in working with recombinant I5 protein?

Researchers working with recombinant I5 protein face several technical challenges:

  • Protein solubility and stability:

    • The highly hydrophobic nature of I5

    • Tendency to aggregate during purification

    • Storage stability issues

    Solutions:

    • Use mild detergents (e.g., DDM, CHAPS) during purification

    • Consider membrane protein purification strategies

    • Include stabilizing agents (glycerol, trehalose) in storage buffers

    • Store as aliquots at -80°C to avoid freeze-thaw cycles

  • Expression optimization:

    • Low expression levels in some systems

    • Potential toxicity to host cells

    Solutions:

    • Test multiple expression systems and conditions

    • Use tightly regulated inducible promoters

    • Optimize codon usage for expression host

    • Consider membrane-targeted expression systems

  • Functional assays:

    • Lack of enzymatic activity for straightforward assays

    • Context-dependent function within virions

    Solutions:

    • Develop virion incorporation assays

    • Establish membrane binding/integration assays

    • Use virus-based functional complementation

How should researchers design proper controls for I5 functional studies?

When conducting functional studies of I5 protein, appropriate controls are essential:

Control TypePurposeImplementation
Negative genetic controlsValidate phenotype specificityI5-null virus (vΔI5)
Positive genetic controlsConfirm rescue of phenotypesReintroduction of wild-type I5
Domain controlsAssess functional requirementsTargeted mutations in key domains
Expression level controlsControl for protein abundance effectsTitrated expression systems
Related protein controlsAssess functional specificityOther small membrane proteins (e.g., A13, I2)
Host cell controlsIdentify cell-type dependenciesMultiple cell lines, primary cells

For virus-based studies, researchers should:

  • Compare multiple independent isolates of mutant viruses

  • Ensure genomic integrity beyond the I5 locus

  • Control for potential second-site mutations

  • Include wild-type virus controls in parallel

For biochemical studies:

  • Include tag-only controls

  • Use related proteins with similar physicochemical properties

  • Perform reciprocal tagging (N-terminal vs. C-terminal)

  • Include appropriate buffer controls

How can researchers optimize immunological detection of I5 in various experimental contexts?

Detecting I5 protein in different experimental settings requires optimized protocols:

  • Immunoblotting/Western blotting:

    • Sample preparation:

      • Use appropriate extraction buffers containing detergents

      • Heat samples at 70°C rather than boiling to prevent aggregation

      • Include reducing agents (DTT or β-mercaptoethanol)

    • Gel systems:

      • Tricine-SDS-PAGE provides better resolution for small proteins

      • Gradient gels (10-20%) optimize separation

    • Transfer conditions:

      • Semi-dry transfer with PVDF membranes

      • Higher methanol percentage (20%) in transfer buffer

      • Lower voltage/longer transfer time

  • Immunofluorescence microscopy:

    • Fixation:

      • 4% paraformaldehyde followed by 0.1% Triton X-100 permeabilization

      • Avoid methanol fixation which can extract membrane proteins

    • Antibody incubation:

      • Higher antibody concentrations may be needed

      • Extended incubation times (overnight at 4°C)

      • Include BSA or normal serum to reduce background

  • Immunoelectron microscopy:

    • Sample preparation:

      • Mild fixation to preserve epitopes

      • Careful dehydration steps

    • Labeling approach:

      • Pre-embedding vs. post-embedding labeling

      • Gold particle size selection (smaller for better resolution)

      • Double-labeling with other viral proteins for colocalization

When using epitope-tagged I5 constructs, consider:

  • Tag position effects (N-terminal vs. C-terminal)

  • Potential interference with protein function

  • Accessibility of the tag in different contexts

  • Background reactivity in control samples

What are the potential roles of I5 in host-pathogen interactions?

Although I5 is dispensable for replication in tissue culture, its conservation across orthopoxviruses suggests important roles in host-pathogen interactions that merit investigation:

  • Immune evasion:

    • Potential interference with host immune recognition

    • Modulation of pattern recognition receptor signaling

    • Protection of virions from innate immune effector mechanisms

  • Host range determination:

    • Cell/tissue tropism effects that manifest in vivo

    • Species-specific interactions with host factors

    • Contribution to viral adaptation to different hosts

  • Cell entry or egress:

    • Modulation of membrane fusion events

    • Interaction with host receptors

    • Contribution to cell-to-cell spread mechanisms

Researchers should design experiments to test these possibilities, including:

  • Comparative infection studies in immune competent vs. deficient systems

  • Investigation of species-specific effects across different host cells

  • Analysis of virion stability and entry kinetics in different cell types

How might I5 be leveraged for vaccinia-based therapeutic applications?

Understanding I5's properties and functions could inform several applications in vectored vaccines and oncolytic therapies:

  • Vector optimization:

    • Modification of I5 to enhance specific properties:

      • Tissue targeting

      • Immune stimulation

      • Vector stability

  • Epitope display platforms:

    • C-terminal fusion of heterologous antigens

    • Surface display for enhanced immunogenicity

    • Multi-epitope presentation systems

  • Oncolytic vaccinia engineering:

    • Tissue-specific targeting modifications

    • Immune modulation for enhanced therapeutic effect

    • Stability enhancement for clinical applications

  • Safety considerations:

    • Since I5 is non-essential for replication, modifications may present minimal risk to vector production

    • Could serve as an additional safety feature in attenuated vaccine platforms

Researchers exploring these applications should conduct systematic structure-function studies to identify regions of I5 amenable to modification without compromising essential properties.

What comparative approaches across poxvirus species might reveal about I5 function?

The conservation of I5 across the chordopoxvirus family provides opportunities for comparative studies:

  • Sequence analysis across species:

    • Identification of absolutely conserved residues

    • Detection of species-specific variations

    • Correlation with host range and pathogenicity

  • Functional complementation studies:

    • Cross-species complementation assays

    • Chimeric I5 proteins with domains from different poxviruses

    • Assessment of host-specific functionality

  • Structural conservation:

    • Comparative modeling of I5 homologs

    • Investigation of conserved structural features

    • Identification of potential functional motifs

  • Context-dependent function:

    • Comparison of I5 requirement across different poxvirus species

    • Correlation with other genomic features

    • Host-specific requirements in different viral backgrounds

Such comparative approaches may reveal subtle functional aspects not apparent in single-species studies and provide insights into the evolutionary significance of this conserved protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.