Recombinant Vaccinia virus Protein J5 (J5L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
J5L; Protein J5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
J5L
Target Protein Sequence
MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN ITKCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI GLLALAILILAFF
Uniprot No.

Target Background

Function
The envelope protein component of the entry-fusion complex is responsible for viral membrane fusion with the host cell membrane during viral entry. It also plays a role in cell-cell fusion (syncytium formation).
Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is Vaccinia virus protein J5 (J5L) and what is its function in viral replication?

J5L is a 15-kDa protein encoded by the J5L (WR097) open reading frame in the Vaccinia virus genome. It functions as a component of the viral entry-fusion complex (EFC), which is crucial for viral membrane fusion and entry into host cells. J5 contains a C-terminal transmembrane domain spanning amino acids 110 to 132 and is characterized by eight conserved cysteine residues that are maintained across poxvirus genera . The protein appears to be essential for viral replication, as indicated by the inability of researchers to isolate viable J5 deletion mutants. Functional studies show that J5-deficient virions have defects in core entry and cannot induce syncytium formation, pointing to its critical role in the membrane fusion necessary for viral infection .

How conserved is J5L protein across different poxviruses?

J5L demonstrates remarkable conservation across the poxvirus family, suggesting its fundamental importance to viral function. In orthopoxviruses, which include Vaccinia virus, the J5 protein is exactly 133 amino acids long with an exceptionally high sequence identity of 96-100% . In other chordopoxvirus genera, while the length of the protein varies, amino acid identity ranges from 62% to 80%. Even in distantly related entomopoxviruses, approximately 30% sequence identity is maintained . Most notably, eight cysteine residues and the C-terminal transmembrane domain are highly conserved across all known poxviruses, underscoring their likely structural or functional significance. This high degree of conservation across evolutionary diverse poxviruses strongly suggests that J5 performs an essential function in the viral life cycle that cannot be substantially altered without compromising viral viability.

What structural relationships exist between J5L and other Vaccinia virus proteins?

J5L shares significant structural homology with the C-terminal portions of two other EFC proteins: A16 and G9 . This similarity suggests that J5, A16, and G9 likely arose through gene duplication events in a common ancestor of all poxviruses. The most striking shared features among these proteins are the conserved cysteine residues and the predicted C-terminal α-helical transmembrane domains . J5 appears to be an N-terminally truncated paralog of A16 and G9, maintaining the critical functional domains while lacking some N-terminal regions present in the other two proteins. This evolutionary relationship provides insight into the functional integration of these proteins within the entry-fusion complex and suggests potential overlapping or complementary roles in mediating viral entry.

What approaches have been used to investigate the function of J5L in Vaccinia virus?

Researchers have employed a combination of genetic and molecular techniques to elucidate J5L function. One primary approach has been the construction of conditional mutants with inducible regulation of J5 expression. Scientists created recombinant viruses (such as vJ5i) where the J5L promoter is replaced with the phage T7 promoter and Escherichia coli lac operator, allowing for IPTG-regulated transcription . To enhance experimental stringency, researchers have combined transcriptional repression with RNA silencing, achieving a 60-fold reduction in infectious virus production compared to controls .

Additional methods include:

  • Affinity purification to confirm J5's association with the EFC

  • Construction of recombinant viruses with epitope-tagged versions of J5 (including flag and strepIII tags)

  • Multiple-sequence alignments to analyze conservation across poxvirus genera

  • Viral infectivity assays to assess the impact of J5 deficiency

  • Syncytium formation assays to evaluate membrane fusion capabilities

These combined approaches have demonstrated that while J5-deficient virions contain a nearly complete complement of viral proteins, they exhibit severely reduced infectivity, highlighting J5's essential role in viral entry .

How can researchers create and validate J5L conditional mutants?

Creating effective J5L conditional mutants requires a multi-step approach:

  • Design and construction: Replace the native J5L promoter with an inducible system such as the T7 promoter coupled with the E. coli lac operator, as demonstrated in the vJ5i construct . For enhanced detection, append an epitope tag (such as the octapeptide flag tag) immediately after the start codon of the J5 open reading frame.

  • Recombination strategy: Use homologous recombination to insert the modified J5L construct into the vaccinia virus genome. Select recombinants through several rounds of plaque purification, potentially using fluorescent markers to aid identification .

  • Validation of regulation: Confirm inducible expression by growing the virus in the presence and absence of inducer (e.g., IPTG) and measuring J5 protein levels through Western blotting. Quantitative PCR can assess transcript levels.

  • Functional assessment: Evaluate virus replication in permissive and non-permissive conditions by measuring virus yield, plaque size, and morphology. For J5, researchers observed an approximately 80% reduction in virus yield without inducer .

  • Enhanced stringency: To achieve more complete suppression, combine transcriptional control with RNA silencing techniques. This combination approach produced a 60-fold reduction in infectious virus yield compared to a 4-5 fold reduction with transcriptional repression alone .

  • Phenotypic analysis: Examine the resulting virions for structural integrity, protein composition, and ability to enter cells and initiate infection. For J5-deficient virions, researchers observed normal particle formation but defects in core entry and membrane fusion .

This methodological approach enables controlled investigation of essential viral proteins like J5L without the limitations encountered when attempting to create complete deletion mutants.

What experimental techniques can determine the localization and interactions of J5L within virions?

Researchers can employ multiple complementary techniques to determine J5L localization and interactions:

For example, researchers have successfully employed affinity purification to demonstrate that J5 is physically associated with other components of the EFC, supporting its functional role in viral entry . These techniques collectively provide a comprehensive view of J5's structural context within the virus particle.

How does the absence of J5L specifically affect the entry-fusion mechanism?

  • Core entry impairment: While J5-deficient virions can successfully bind to host cells, they fail to efficiently deliver their viral cores into the cytoplasm . This suggests that J5 plays a specific role in the post-attachment steps of viral entry, potentially in the membrane fusion events that allow core release.

  • Syncytium formation defect: J5-deficient virions show an inability to induce syncytium formation . Since syncytia result from cell-cell fusion mediated by viral proteins at the cell surface, this defect further implicates J5 in membrane fusion processes.

These findings suggest that J5 functions in concert with other EFC components to facilitate the conformational changes or protein-protein interactions necessary for membrane fusion. The specific molecular mechanisms might involve:

  • Stabilizing the EFC complex structure

  • Mediating interactions between fusion proteins

  • Participating directly in membrane destabilization

  • Triggering conformational changes in other EFC components

Understanding these precise mechanisms requires further structural and functional studies of J5 within the context of the complete EFC.

What is the evolutionary relationship between J5L and the paralogous proteins A16 and G9?

The evolutionary relationship between J5L, A16, and G9 reveals important insights into poxvirus entry mechanisms:

  • Paralogous relationship: Multiple sequence alignments demonstrate that J5 is an N-terminally truncated paralog of A16 and G9 . This suggests that these three proteins originated from gene duplication events in a common ancestor of all poxviruses.

  • Conserved features: The most striking similarities between these three proteins are:

    • The conservation of cysteine residues, suggesting similar disulfide bonding patterns

    • Predicted C-terminal α-helical transmembrane domains with similar properties

    • Functional integration within the EFC

  • Functional specialization: Despite their homology, each protein appears to have evolved distinct functions that cannot be compensated by the others, as evidenced by the essential nature of each in viral replication.

  • Evolutionary conservation: The relationship between these three proteins is maintained across all poxvirus genera, indicating strong selective pressure to preserve their specialized functions .

This evolutionary perspective suggests that the EFC developed increased complexity through gene duplication and specialization, perhaps enabling more sophisticated control of the entry process or adaptation to different host cell types. Future research comparing the precise roles of J5, A16, and G9 could reveal how these paralogous proteins have evolved complementary functions within the entry machinery.

How does J5L contribute to the broader immunological response to Vaccinia virus infection?

The role of J5L in immunological responses appears to be complex and multifaceted:

  • T-cell responses: Studies of CD4 T-cell responses to vaccinia virus have shown extensive diversity, with responses detected for 122 open reading frames (68% of those tested) . While the search results don't specifically highlight J5L among the most frequently recognized antigens, its essential role in viral entry suggests it may be relevant to immune recognition.

  • Conservation and immune targeting: The high conservation of J5L across poxviruses indicates it might be under selective pressure from host immunity. Highly conserved viral proteins often represent critical functional elements that cannot readily mutate to escape immune detection without compromising viral fitness.

  • Potential vaccine target: The association of J5L with the entry-fusion complex makes it potentially relevant for vaccine development. Research has shown that targeting multiple components of this complex can enhance protective immunity .

  • Experimental approaches: To study J5L's immunological significance, researchers could:

    • Assess J5L-specific antibody responses in vaccinated individuals or infected animals

    • Determine if J5L-specific T cells contribute to protection

    • Evaluate J5L as a component in subunit vaccine formulations

    • Study whether mutations in J5L affect immune escape

The search results suggest a methodology where genomic expression libraries have been used to identify CD4 T-cell responses to vaccinia virus proteins , which could be applied specifically to investigate J5L immunogenicity.

What structural studies would advance our understanding of J5L function?

Advanced structural studies of J5L would significantly enhance our understanding of its function within the entry-fusion complex:

  • Crystallography or Cryo-EM of isolated J5L: Determining the three-dimensional structure of purified J5L would reveal the spatial arrangement of its conserved cysteine residues and transmembrane domain. This could be particularly challenging due to J5L's membrane association, potentially requiring detergent solubilization or lipid nanodiscs.

  • Structure of J5L within the EFC complex: Cryo-electron microscopy of the entire EFC with J5L in its native context would reveal interaction interfaces with other complex components. This approach would be especially valuable since J5L functions as part of a multi-protein assembly.

  • Disulfide bonding pattern analysis: Given the conservation of eight cysteine residues across poxviruses , mapping the disulfide bonding pattern through mass spectrometry would provide insights into J5L's structural stabilization.

  • Transmembrane domain structure: NMR studies of the C-terminal transmembrane domain (amino acids 110-132) could reveal its orientation in the membrane and potential interaction with lipids or other transmembrane proteins.

  • Structural comparison with A16 and G9: Comparative structural analysis with its paralogous proteins would highlight both shared structural elements and unique features that evolved after gene duplication.

These structural approaches, combined with existing functional data, would provide a comprehensive model of how J5L contributes to membrane fusion during viral entry, potentially informing the development of targeted antiviral strategies.

What are the most effective strategies for creating J5L-deficient Vaccinia viruses for research?

Creating effective J5L-deficient viruses requires carefully calibrated approaches due to J5L's essential nature:

StrategyAdvantagesLimitationsSuccess Metrics
IPTG-inducible transcriptional controlTunable expression; relatively simple genetic modificationLeaky expression (80% reduction without inducer) Virus yield; J5L protein detection by Western blot
RNA silencingCan target mRNA from any promoterIncomplete silencing (2-fold reduction) mRNA levels by qPCR; virus yield
Combined transcriptional control and RNA silencingEnhanced stringency (60-fold reduction) Complex genetic manipulation requiredVirus yield; infectivity assays
Temperature-sensitive mutationsRapid inactivation upon temperature shiftRequires screening many mutants; potential off-target effectsGrowth at permissive vs. non-permissive temperatures
Dominant-negative J5L mutantsCan block function even with wild-type protein presentRequires knowledge of functional domainsInhibition of wild-type virus growth

The research presented in the search results indicates that the most effective approach thus far has been combining transcriptional repression with RNA silencing, which achieved a 60-fold reduction in infectious virus production . This level of suppression enabled researchers to produce sufficient quantities of J5-deficient virions for functional studies while preventing the generation of reversion mutants that might arise with less stringent methods.

For future research, CRISPR-based approaches that allow for more precise genetic control, possibly combined with degron-based protein degradation systems, might provide even more stringent regulation of J5L expression.

How might understanding J5L function contribute to development of safer poxvirus-based vaccines?

Understanding J5L function has several potential applications for developing safer poxvirus-based vaccines:

  • Attenuated vaccine strains: The knowledge that J5L is essential for viral entry suggests that engineered viruses with regulated J5L expression could serve as attenuated vaccine platforms with controlled replication capacity. Conditional expression systems could allow for single-cycle replication, enhancing safety while maintaining immunogenicity.

  • Subunit vaccine design: J5L's role in the entry-fusion complex makes it a potential candidate for inclusion in subunit vaccines. Research has shown that combining multiple VACV antigens can enhance protection; for example, a four-gene construct (the "4-pox" vaccine) containing A27L, A33R, B5R, and L1R has demonstrated protective efficacy . Adding J5L to such combinations might further improve protection.

  • Host-range modification: Since J5L is involved in viral entry, modifications to this protein might allow for the development of poxvirus vectors with altered host or tissue tropism, potentially restricting replication to specific cell types for enhanced safety.

  • Rational design of entry inhibitors: Structural understanding of J5L function could inform the development of small molecule inhibitors that specifically target the entry process, providing both antiviral therapies and tools to control replication of vaccine vectors.

  • Cross-protective immunity: The high conservation of J5L across poxviruses suggests that immune responses directed against this protein might contribute to cross-protection against multiple poxvirus species, an important consideration for vaccines designed to protect against emerging poxvirus threats.

By leveraging our understanding of J5L's essential function, researchers can develop next-generation poxvirus vaccines with improved safety profiles while maintaining robust immunogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.