Recombinant Vaccinia virus Protein J5 (MVA089L, ACAM3000_MVA_089)

Shipped with Ice Packs
In Stock

Description

Role in Vaccinia Virus Biology

MVA is a replication-deficient strain developed through >500 passages in chick embryo fibroblasts, rendering it safer for research and clinical use . Protein J5 contributes to:

  • Viral morphogenesis: Despite MVA’s replication deficiency, J5 retains structural roles observed in wild-type vaccinia .

  • Immune modulation: Recombinant vaccinia proteins like J5 enable studies of antigen presentation and T-cell responses .

Applications in Vaccine Research

Recombinant vaccinia viruses expressing foreign antigens are tools for:

  • Antibody production: Native conformational epitopes are preserved in mammalian cells .

  • Cellular immunity studies: Cytotoxic T-cell responses to HIV-1 and influenza antigens have been characterized using similar vectors .

Table 1: Key advantages of MVA-based recombinant proteins

FeatureBenefit
SafetyNon-replicating in human cells
Antigen PresentationInduces humoral and cell-mediated immunity
ScalabilityCost-effective production in E. coli

Stability and Engineering Challenges

Studies on recombinant MVA (rMVA) highlight instability risks:

  • Frameshift mutations: Occur in homopolymeric nucleotide runs (e.g., 6 consecutive Gs/Cs) within inserted genes .

  • Deletions: Large genomic deletions in env inserts flanked by non-essential MVA regions .

Mitigation strategies:

  • Codon optimization: Silent mutations disrupting homonucleotide runs improved gag-pol stability from <1% to >99% expression after 6 passages .

  • Insertion site selection: Positioning genes between conserved essential genes (e.g., I8R-G1L) reduced deletion rates .

Future Directions

Ongoing research aims to:

  • Enhance stability via codon optimization and strategic gene insertion .

  • Expand use in multi-valent vaccines leveraging MVA’s large DNA capacity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MVA089L; ACAM3000_MVA_089; Protein J5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Vaccinia virus (strain Ankara) (VACV)
Target Names
MVA089L
Target Protein Sequence
MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN ITKCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI GLLALAILILAFF
Uniprot No.

Target Background

Function

Envelope protein component of the entry-fusion complex. It mediates viral membrane fusion with the host cell membrane during viral entry and also contributes to cell-cell fusion (syncytium formation).

Database Links

KEGG: vg:3707553

Protein Families
Poxviridae A16/G9/J5 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is Protein J5 and what is its role in Vaccinia virus replication?

Protein J5 is a 15-kDa protein encoded by the J5L (WR097) open reading frame in Vaccinia virus. It functions as an essential component of the viral entry-fusion complex (EFC), which facilitates viral membrane fusion and entry into host cells. J5 has been identified as the 11th protein to be functionally characterized as part of the EFC .

Research has demonstrated that J5-deficient virions can bind to cells but exhibit significant defects in core entry and an inability to induce syncytium formation, highlighting its critical role in the viral entry process . The conservation of J5 across all poxviruses and the inability to isolate J5 deletion mutants strongly suggests that this protein plays an essential function in viral replication .

How is J5 structurally characterized?

J5 is characterized by several key structural features:

  • A predicted molecular weight of 15 kDa

  • A C-terminal transmembrane domain spanning amino acids 110-132

  • Eight highly conserved cysteine residues across poxvirus genera

  • A C-terminal α-helical transmembrane domain

The protein's structure shares significant similarity to the C-terminal portions of two other EFC proteins, A16 and G9, suggesting that these proteins likely arose through gene duplication events in a common ancestor of all poxviruses . This structural homology provides important insights into the evolutionary relationships between poxvirus entry proteins.

How conserved is J5 protein across different poxvirus species?

J5 demonstrates remarkable conservation across poxvirus genera, highlighting its evolutionary importance. Sequence analysis reveals:

  • In orthopoxviruses: The J5 ORF is exactly 133 amino acids with 96-100% identity

  • In other chordopoxvirus genera: The protein length varies with 62-80% amino acid identity

  • In entomopoxviruses: Approximately 30% amino acid identity

The most striking feature of this conservation is the preservation of eight cysteine residues and the predicted C-terminal α-helical transmembrane domain across all poxvirus genera . This high degree of conservation strongly suggests that J5 plays a fundamental role in the poxvirus life cycle that has been maintained throughout viral evolution.

What experimental approaches are recommended for initial J5 characterization?

For researchers beginning work with J5 protein, several foundational experimental approaches are recommended:

  • Epitope tagging: Adding flag or strepIII tags to the N-terminus of J5 allows for detection and affinity purification .

  • Conditional expression systems: Constructing inducible J5 mutants (e.g., using the IPTG-inducible T7 RNA polymerase system) enables controlled expression studies .

  • Protein interaction analysis: Western blotting with antibodies against known EFC proteins following affinity purification can validate J5's association with the complex .

  • Viral infectivity assays: Plaque assays comparing wild-type and J5-deficient viruses can quantify the impact of J5 depletion on viral replication .

These techniques provide a methodological foundation for characterizing J5's basic properties before advancing to more sophisticated functional studies.

How can synergistic approaches overcome limitations in studying J5 function?

Single methodological approaches to studying J5 function have shown limitations. Research demonstrates that combining transcriptional repression and RNA silencing creates synergistic effects that provide more definitive insights:

MethodVirus Yield ReductionDetection of J5 by Western Blot
Transcriptional repression alone~80% reduction (3-4 fold)Below detection threshold
RNA silencing alone~50% reduction (2 fold)Below detection threshold
Combined approach~98% reduction (60 fold)Below detection threshold

This synergistic approach revealed that while neither technique alone could completely eliminate J5 function, their combination produced a dramatic 60-fold reduction in infectious virus yield . This methodological advancement resolves the apparent contradiction between the inability to isolate J5 deletion mutants (suggesting essentiality) and the incomplete inhibition observed with single approaches.

The protocol involves:

  • Transfecting cells with J5-targeted siRNAs or control siRNAs

  • Infecting the transfected cells with a J5-inducible virus in the presence or absence of inducer

  • Measuring viral yield through plaque assays

This combined approach is particularly valuable for studying proteins where even minimal expression may support partial function.

What methodological considerations should be addressed when analyzing J5-deficient virions?

Analysis of J5-deficient virions requires careful experimental design to distinguish between defects in viral assembly, morphogenesis, and entry. Key methodological considerations include:

  • Virion protein composition analysis: Ensure that J5-deficient virions contain a full complement of other viral proteins, confirming that defects are not due to broad assembly disruption .

  • Multi-step infectivity assays: Distinguish between binding defects and post-binding entry failures by measuring:

    • Virion attachment to cells

    • Core entry into the cytoplasm

    • Syncytium formation capacity

  • Experimental controls: Include parallel experiments with wild-type virus and viruses deficient in other EFC components to differentiate J5-specific phenotypes .

  • Detection sensitivity: Consider that analytical methods may have insufficient sensitivity to detect very low levels of J5 expression that could still support partial function .

What techniques are effective for studying J5's interactions within the entry-fusion complex?

Several complementary techniques can illuminate J5's interactions within the EFC:

  • Affinity purification with tagged J5: Using N-terminally strepIII-tagged J5 constructs (e.g., vV5L5istrepJ5) allows isolation of J5 and its interacting partners. This approach has confirmed J5's association with EFC proteins including A21, A28, H2, and L5 .

  • Mass spectrometry analysis: Following affinity purification, mass spectrometry can identify additional interaction partners, including A16 and G9 .

  • Controlled destabilization experiments: By repressing expression of other EFC components (e.g., L5), researchers can determine whether J5's interactions are dependent on complex integrity. When L5 was repressed, the complex destabilized, preventing copurification of EFC proteins with J5 .

  • Reciprocal tagging experiments: Comparing results from affinity purification of different tagged EFC components can validate interactions and reveal the architecture of the complex .

These techniques collectively provide a comprehensive view of J5's position and role within the multiprotein entry-fusion complex.

How can experimental designs resolve contradictory data about J5 essentiality?

Resolving the contradiction between the inability to isolate J5 deletion mutants and the incomplete inhibition of virus replication under apparent complete repression requires carefully designed experiments:

  • Statistical analysis of repression efficiency: Quantitative assessment of J5 mRNA and protein levels under repression conditions can reveal whether residual expression occurs below Western blot detection thresholds .

  • Dose-response experiments: Systematically varying the degree of J5 repression (e.g., with different IPTG concentrations or siRNA amounts) can establish the minimal J5 threshold required for function .

  • Single-virion analyses: Advanced imaging techniques might determine whether functional EFCs are present on virions in reduced numbers that still permit some entry events .

  • Hypothesis testing for excess EFCs: Design experiments to test whether vaccinia virions contain excess EFCs, potentially explaining how viruses with greatly reduced J5 levels might still initiate infection. This parallels observations in other viral systems, such as HIV, where a single envelope trimer is sufficient for entry .

These experimental approaches demonstrate how sophisticated research design can address seemingly contradictory data and generate new hypotheses about the stoichiometry and function of viral entry complexes.

What are the experimental challenges in analyzing the relationship between J5 and its paralogs A16 and G9?

The evolutionary relationship between J5 and its paralogs A16 and G9 presents unique experimental challenges:

  • Functional redundancy assessment: Design experiments to determine whether these proteins have partially overlapping functions, potentially explaining the incomplete inhibition observed when J5 alone is repressed .

  • Domain swapping experiments: Create chimeric constructs exchanging domains between J5, A16, and G9 to identify which regions confer specific functions versus shared activities .

  • Synchronized repression systems: Develop experimental systems allowing simultaneous controlled repression of multiple paralogs to assess potential synergistic effects .

  • Evolutionary analysis: Compare the functions of these proteins across different poxvirus genera to understand how their roles have diverged or been conserved following gene duplication events .

  • Structural biology approaches: Consider X-ray crystallography or cryo-EM studies to determine how the structural similarities between these proteins relate to their functions within the EFC .

These experimental approaches can help resolve whether J5 and its paralogs represent a case of functional specialization following gene duplication or if they retain overlapping functions in contemporary poxviruses.

What experimental design principles are most important when studying J5 function?

When designing experiments to study J5 function, several key principles from experimental methodology should be applied:

  • Variable control: Identify and control extraneous variables that may confound results when manipulating J5 expression .

  • Proper hypothesis formulation: Develop clear null and alternative hypotheses about J5 function that can be tested through experimental manipulation .

  • Treatment design: Systematically manipulate independent variables (e.g., J5 expression levels) to observe effects on dependent variables (e.g., virus infectivity, EFC formation) .

  • Randomization: Ensure that experimental units are randomly assigned to different conditions to minimize systematic bias .

  • True experimental design: Implement control groups alongside experimental groups with proper randomization to establish causality rather than mere correlation .

How should researchers approach data inconsistencies in J5 studies?

When faced with inconsistent or contradictory data regarding J5 function, researchers should:

  • Examine methodological differences: Analyze whether discrepancies arise from differences in experimental techniques, viral strains, or cell types used across studies .

  • Consider sensitivity limitations: Evaluate whether detection methods have sufficient sensitivity to capture low levels of protein expression that may still support function .

  • Design reconciling experiments: Develop new experimental approaches specifically aimed at resolving apparent contradictions, as demonstrated by the synergistic repression and silencing approach .

  • Formulate integrative hypotheses: Develop new hypotheses that can account for seemingly contradictory observations, such as the possibility that vaccinia virions might contain excess EFCs .

  • Implement control analyses: Include additional controls to rule out alternative explanations for unexpected results .

This methodical approach to resolving data inconsistencies exemplifies the scientific process of continuous refinement through hypothesis testing and experimental innovation.

What are promising approaches for further characterizing J5's role in viral entry?

Several sophisticated approaches could advance our understanding of J5's precise role in viral entry:

  • High-resolution imaging: Apply super-resolution microscopy or cryo-electron tomography to visualize J5's position and conformational changes during the entry process .

  • Single-particle fusion assays: Develop in vitro systems to monitor individual fusion events mediated by purified EFCs with defined J5 content .

  • Quantitative proteomics: Implement SILAC or TMT labeling to quantitatively assess the stoichiometry of J5 relative to other EFC components under various conditions .

  • Structure-function studies: Use systematic mutagenesis of conserved residues, particularly the eight conserved cysteines, to identify domains critical for J5 function .

  • Comparative systems: Extend studies to EFC components in diverse poxvirus species to determine whether J5's function is universally conserved or has evolved species-specific features .

These approaches would build upon existing knowledge to provide a more mechanistic understanding of how J5 contributes to poxvirus entry.

How might recombinant J5 proteins contribute to vaccine development research?

The essential role of J5 in viral entry suggests potential applications in vaccine research:

  • Subunit vaccine components: Evaluate whether recombinant J5 proteins can elicit neutralizing antibodies that block viral entry .

  • Attenuated vaccine platforms: Develop vaccinia vectors with regulated J5 expression as potential attenuated vaccine platforms with controlled replication capacity .

  • Immunogenicity testing: Assess whether J5's conserved epitopes might elicit cross-protective immunity against multiple poxvirus species .

  • Adjuvant development: Investigate whether J5-derived peptides might function as immunostimulatory components when included in vaccine formulations .

These research directions could expand the utility of J5-related knowledge beyond basic virology into practical applications for vaccine development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.