Recombinant Vaccinia virus Protein L1 (L1R)

Shipped with Ice Packs
In Stock

Description

Introduction

The Vaccinia virus (VACV) was used as a preventative vaccine against smallpox, which led to the eradication of the disease . The L1 protein, also known as L1R, is a myristoylated transmembrane protein of 250 residues found on the surface of the intracellular mature virion (IMV) form of the virus . The L1 protein plays a vital role in infection and morphogenesis, is well-conserved among orthopoxviruses, and is a target for neutralizing antibodies .

Structure and Function

L1R is a myristoylated transmembrane protein . Myristoylation, the attachment of myristate (a fatty acid) to a protein, occurs at the N-terminal glycine residue and is crucial for virus assembly and infection . L1 is essential for viral maturation; vaccinia viruses with the L1 gene deleted cannot mature . The 185-residue ectodomain of L1, which contains disulfide bonds, is located in the cytoplasm before cell lysis .

Role in Virion Assembly

The L1R protein is a component of both intracellular mature virus particles and extracellular enveloped virions and is associated with the primary membranes surrounding the virion core . Research indicates that myristic acid facilitates essential interactions between the L1R protein and viral membranes or other virion components, which leads to the assembly, maturation, and release of viral particles .

Immunogenicity and Vaccine Development

L1 has been utilized in multigene DNA vaccines that can block lethal viral challenges in both mice and nonhuman primates . A multicomponent protein vaccine that contains L1 has also been shown to block vaccinia virus infection in mice .

4.1. Enhancement of Immunogenicity

To improve the immunogenicity of L1R, researchers have explored the addition of a tissue plasminogen activator (tPA) signal sequence to the L1R gene . The tPA signal sequence directs the L1 protein into the cellular secretion pathway, enhancing its expression and presentation to the immune system .

4.2. DNA Vaccine Studies

Studies have shown that a tPA-L1R construct produces a more robust neutralizing antibody response in vaccinated mice when administered as a DNA vaccine via gene-gun prime/single boost . The tPA leader sequence enhances the interaction of the L1 molecule with conformationally dependent and potently neutralizing antibodies .

4.2.1. Antibody Response

Mice vaccinated with tPA-L1R DNA had detectable anti-L1 antibodies after the prime vaccination, whereas those vaccinated with unmodified L1R did not . After the boost, the anti-L1 response in tPA-L1R vaccinated animals was significantly greater than in those vaccinated with unmodified L1R .

4.2.2. Neutralizing Activity

The 50% neutralizing titers (PRNT50s) correlated with the titers observed in the ELISA. There was significant neutralizing activity in the serum from tPA-L1R-vaccinated mice after the boost, with a mean PRNT50 titer over 550 . The mean PRNT50 titer in the unmodified L1R-vaccinated mice was approximately 14-fold lower .

The table below shows the impact of the tPA leader sequence on neutralizing antibody responses against L1:

L1RtPA-L1R
Anti-L1 Antibodies After PrimeBelow level of detectionDetectable, titer of ∼2
Anti-L1 Antibodies After BoostIncreased to 2.6 log titersIncreased to 3.7 log titers
PRNT50 Titers After BoostApproximately 14-fold lower than tPA-L1RMean PRNT50 titer over 550

4.3. Fowlpox-Based Recombinant Vaccine

A novel fowlpox-based recombinant (FP) was constructed with the tPA signal sequence linked to the 5′ end of the L1R gene (FP tPA-L1R) to drive the L1 protein into the cellular secretion pathway . The L1 protein expressed by FP tPA-L1R shows both cytoplasmic and membrane subcellular localization in CEF, non-human primate Vero, and human MRC-5 cells .

Role in Protection Against Orthopoxviruses

L1R has been used as a DNA vaccine and in adenovirus-vectored vaccines, protecting mice from lethal challenges . Adding a tPA-leader sequence can enhance the immunogenicity of the L1R gene when given as a DNA vaccine . Substituting the tPA-L1R construct for the unmodified L1R gene in the 4pox vaccine, administered as a prime and single boost, better protected animals from lethal challenge with vaccinia virus (VACV) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
L1R; Protein L1; Virion membrane protein M25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-250
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
L1R
Target Protein Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAG TGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDMQN
Uniprot No.

Target Background

Function

The envelope protein likely plays a crucial role in viral entry into the host cell. It is believed to mediate viral attachment to the host cell surface and interacts with the entry/fusion complex (EFC). This protein is essential for the fusion and penetration of the viral core into the host cell.

Protein Families
Chordopoxvirinae L1 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the structure of the Vaccinia virus L1 protein?

L1 is a 250-amino-acid myristoylated transmembrane protein with a C-terminal transmembrane domain that spans residues 186 to 204. The atomic structure of the L1 ectodomain has been solved to 1.51 Å resolution, revealing a fold composed of a bundle of α-helices packed against a pair of two-stranded β-sheets . The protein contains three intramolecular disulfide bonds that are formed by the poxvirus cytoplasmic redox system . Notably, the structure reveals a hydrophobic cavity located adjacent to its N-terminus that is capable of shielding the myristate moiety, which is essential for virion assembly .

What is the biological function of L1 in Vaccinia virus lifecycle?

L1 plays dual critical roles in both virus morphogenesis and infection. It associates with the virus-encoded multiprotein entry-fusion complex (EFC) and is essential for viral entry into cells . Studies using conditional null mutants (vL1Ri) have demonstrated that in the absence of L1, virus particles can assemble and undergo morphogenesis, but the resulting virions are non-infectious . Specifically, L1-deficient virions can attach to cells, but the cores fail to penetrate into the cytoplasm. Additionally, L1 is required for membrane fusion, as cells infected with vL1Ri in the absence of inducer do not form syncytia following brief low-pH treatment .

How conserved is L1 across poxviruses?

L1 is highly conserved throughout the poxvirus family and is nearly identical in vaccinia virus and variola virus (which causes smallpox) . This conservation makes it an attractive target for broad-spectrum antipoxvirus therapeutics and vaccines. For example, L1 shows 98.8% similarity with the M1 monkeypox virus (MPXV) ortholog, further highlighting its conservation across orthopoxviruses .

What are the most effective expression systems for producing recombinant L1 protein?

Recombinant L1 protein has been successfully expressed in several systems:

  • E. coli expression system: The ectodomain of L1 (residues 1-185) has been expressed in E. coli, typically as a His-tagged or GST-fusion protein. For proper folding, the protein often requires refolding procedures after purification from inclusion bodies .

  • Baculovirus expression system: This system has been used to produce a more natively folded protein with the correct disulfide bonding, particularly for the L1 ectodomain (residues 2-183) with N-terminal His-tag and C-terminal Myc-tag modifications .

  • Viral vector expression: Novel approaches include using fowlpox-based recombinants, such as FP tPA-L1R, in which the tissue plasminogen activator signal sequence is linked to the 5′ end of the L1R gene to enhance protein expression and drive the L1 protein into the cellular secretion pathway .

What purification approach is recommended for obtaining high-purity L1 protein?

A multi-step purification process is typically employed:

  • For His-tagged L1 protein from E. coli inclusion bodies:

    • Solubilize inclusion bodies using denaturing buffer (e.g., 100 mM Tris·HCl, 6 M guanidine-HCl, and 2 mM DTT)

    • Perform refolding procedures

    • Purify using Ni-NTA affinity chromatography with elution in 0.2 M imidazole, 20 mM Tris, pH 8.0, 0.3 M NaCl

    • Further purify by gel filtration chromatography using a Superdex 200 size-exclusion column

  • Verify proper protein folding by ELISA using different anti-L1 antibodies to ensure the protein exhibits the correct conformational epitopes .

How do antibodies neutralize Vaccinia virus through L1 targeting?

Studies have identified distinct mechanisms of L1-targeted neutralization:

  • Monoclonal antibodies (MAbs) against L1 can be grouped into different epitope clusters. While some anti-L1 antibodies fail to neutralize, one group potently neutralizes VACV in an isotype- and complement-independent manner .

  • This is notably different from neutralizing antibodies against other major VACV envelope proteins (H3, D8, or A27), which require complement-fixing isotypes and the presence of complement for complete neutralization .

  • Neutralizing anti-L1 MAbs bind to recombinant L1 protein with significantly higher affinity than non-neutralizing MAbs and can bind directly to virions .

  • The epitope for potent neutralizing antibodies has been mapped to a conformational epitope with Asp35 as the key residue, similar to the epitope of 7D11, a previously characterized potent VACV neutralizing antibody .

What experimental approaches can be used to map neutralizing epitopes on L1?

Several complementary techniques have been employed to map neutralizing epitopes:

  • Isolation of neutralization escape mutants: Viruses that develop resistance to neutralizing antibodies can be sequenced to identify mutations in the L1 gene .

  • Hydrogen/deuterium exchange mass spectrometry: This technique identifies regions of the protein that show differential solvent accessibility when bound to antibodies .

  • X-ray crystallography: The structure of L1 complexed with antibody fragments (e.g., Fab fragments) provides atomic-level details of the epitope-paratope interaction .

  • Alanine scanning mutagenesis: Systematic replacement of surface-exposed residues with alanine can identify amino acids critical for antibody binding .

What is the relationship between antibody binding affinity to L1 and neutralization potency?

Research has revealed several important insights:

  • Neutralizing antibodies bind to L1 with significantly higher affinity than non-neutralizing antibodies, suggesting a threshold affinity may be required for neutralization .

  • The neutralizing antibodies recognize a conformational epitope primarily through CDR1 and CDR2 of the heavy chain, which are highly conserved among antibodies recognizing this epitope .

  • Despite targeting the same epitope, these antibodies have divergent light-chain and heavy-chain CDR3 sequences, indicating multiple solutions for targeting this vulnerability .

  • This suggests that the conformational L1 epitope with Asp35 represents a common site of vulnerability for potent neutralization by antibodies with different genetic origins .

How does L1 contribute to the virus entry process?

L1 is an essential component of the viral entry machinery:

  • L1 physically interacts with the entry/fusion complex (EFC), which is comprised of at least eight viral proteins (A16, A21, A28, G3, G9, H2, J5, and L5) along with an associated protein (F9) .

  • Coimmunoprecipitation experiments have demonstrated that L1 interacts with the EFC and indirectly with F9, confirming its role as a component of the viral entry apparatus .

  • In the absence of L1, virions can attach to cells but cores fail to penetrate into the cytoplasm, demonstrating its specific role in the entry process rather than initial attachment .

  • L1 is also required for membrane fusion, as evidenced by the inability of cells infected with L1-deficient virus to form syncytia following low-pH treatment .

What experimental systems have been developed to study L1's role in the virus lifecycle?

Several specialized systems have been employed:

  • Inducible null mutants: The recombinant VACV (vL1Ri) that inducibly expresses L1 under the control of the E. coli lac operator and a constitutively expressed lac repressor gene has been crucial for distinguishing between L1's roles in entry versus assembly .

  • Particle/PFU ratio analysis: Comparing the number of physical virus particles to plaque-forming units for virions produced with or without L1. The average particle/PFU ratios for virions made in the presence and absence of IPTG (inducer) were approximately 65 and 4,800, respectively, demonstrating a ~75-fold difference in infectivity .

ExperimentConditionNumber of particlesPFUParticle/PFU ratio
1vL1Ri with IPTG8.0 × 10¹⁰1.3 × 10⁹62
1vL1Ri without IPTG13.3 × 10¹⁰3.3 × 10⁷4,000
2vL1Ri with IPTG8.3 × 10¹⁰1.2 × 10⁹69
2vL1Ri without IPTG14.0 × 10¹⁰2.5 × 10⁷5,600
  • Protein-protein interaction studies: Two-hybrid analysis has been used to detect interactions between L1 and other viral proteins, helping to map the viral protein interaction network .

How has L1 been incorporated into experimental vaccines against poxviruses?

L1 has been a key component of several vaccine strategies:

  • Multicomponent DNA vaccines: L1 has been included in DNA vaccines along with other immunogenic proteins (such as A27, A33, and B5), which have shown protection against lethal viral challenge in mice and non-human primates .

  • Protein subunit vaccines: Recombinant L1 protein has been used in multicomponent protein vaccines that have demonstrated protection against vaccinia virus infection in mice .

  • Viral vector vaccines: Novel approaches include fowlpox-based recombinants expressing L1, such as FP tPA-L1R, designed to enhance immunogenicity when used as a boost after DNA vaccination .

What are the challenges in using L1 as a vaccine component, and how are researchers addressing them?

Several challenges and solutions have been identified:

  • Limited immunogenicity: When used alone, L1-based vaccines showed lower efficacy in non-human and human primates . To address this:

    • Researchers have developed prime-boost strategies combining DNA vaccines with viral vector boosts

    • Modified L1 constructs with tissue plasminogen activator (tPA) signal sequence have been created to enhance expression and direct the protein to the secretory pathway

  • Proper folding and epitope presentation: The neutralizing epitopes on L1 are conformational, requiring properly folded protein for effective immune responses:

    • Expression systems that preserve disulfide bonding and protein conformation have been developed

    • The addition of signal sequences (like tPA) can improve proper folding and presentation

How does L1 immunogenicity compare to other poxvirus antigens in vaccine formulations?

Comparative studies have provided important insights:

  • In vaccine formulations comparing L1 to other antigens like A27:

    • Mice immunized with A27 and A33 were not as well protected as mice receiving L1 and A33

    • Despite similar levels of neutralizing antibodies developed after immunizations with A27 or L1, A27-immunized mice exhibited more severe disease upon intranasal challenge with vaccinia virus

  • The passive administration of antibody to A27 was poorly protective compared to antibody to L1, despite equivalent in vitro neutralizing activities, highlighting the unique protective qualities of anti-L1 antibodies .

  • Trivalent vaccines containing A33, B5, and L1 were more protective than formulations where L1 was replaced with A27 .

How can L1 N-myristoylation be validated and its significance studied?

The myristoylation of L1 is critical for its function and can be studied through:

  • Chemical proteomics approaches: Using alkyne-tagged myristic acid analogues (YnMyr) that can be coupled to reporter tags via click chemistry :

    • Cells are labeled with YnMyr during infection

    • Labeled proteins are conjugated to azide-containing reporters (e.g., AzRB) via copper-catalyzed azide-alkyne cycloaddition (CuAAC)

    • L1 is detected by enrichment on streptavidin beads followed by Western blotting with anti-L1 antibodies

  • Mutational analysis: Creating L1 variants with mutations at the N-terminal glycine (the myristoylation site) to assess the impact on protein localization and virus infectivity.

What approaches can be used to study L1's interactions with the entry/fusion complex (EFC)?

Several methodologies have proven valuable:

  • Coimmunoprecipitation: Using antibodies against L1 or EFC components to pull down protein complexes and identify interacting partners .

  • Two-hybrid analysis: Systematic screening of pairwise interactions between L1 and other viral proteins to map the protein interaction network .

  • Cryo-electron microscopy: Structural analysis of intact virions or purified protein complexes to visualize L1's arrangement in the context of the EFC.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry analysis to identify proteins in close proximity to L1 and map interaction interfaces.

How can structural information about L1 be leveraged for rational drug design?

The 1.51 Å crystal structure of L1 provides opportunities for structure-based approaches:

  • Target the hydrophobic cavity: The structure reveals a hydrophobic cavity adjacent to the N-terminus that could shield the myristate moiety. This cavity could be targeted with small molecules that might interfere with L1's essential functions .

  • Disrupt protein-protein interactions: Using the structural information to design peptides or small molecules that mimic interaction surfaces between L1 and other components of the entry machinery.

  • Structure-based immunogen design: Engineering L1-based immunogens that better present neutralizing epitopes, potentially improving vaccine efficacy.

  • Antibody-guided drug design: Using the structures of L1-antibody complexes to inform the design of therapeutics that mimic the binding mode of neutralizing antibodies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.