Recombinant Vaccinia virus Protein L1 (VACWR088)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
VACWR088; L1R; Protein L1; Virion membrane protein M25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-250
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR088
Target Protein Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAG TGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDMQN
Uniprot No.

Target Background

Function
This envelope protein likely facilitates viral entry into host cells. It is believed to mediate virus attachment to the host cell surface and associate with the entry/fusion complex (EFC). It is essential for fusion and penetration of the viral core into the host cell.
Database Links

KEGG: vg:3707544

Protein Families
Chordopoxvirinae L1 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the structural and functional significance of Vaccinia virus Protein L1 (VACWR088)?

Protein L1/VACWR088 is a 250-amino acid myristoylated protein with a C-terminal transmembrane domain that spans residues 186 to 204. The protein forms a critical component of the entry fusion complex (EFC), which comprises 11 proteins that collectively facilitate the entry of the virion core into the host cytoplasm .

Structurally, the N-terminal portion of L1 (which is expressed at the surface of the virion) folds as a bundle of α-helices surrounding a pair of β-strands . This N-terminal region is highly conserved among orthopoxviruses, with only one and two amino acid differences between vaccinia and smallpox and monkeypox counterparts, respectively .

Functionally, L1 facilitates viral entry through a two-step process involving lipid mixing and pore formation. Unlike most EFC proteins, L1 (along with F9) is not required for the assembly or stability of the complex but instead plays a specific role in the entry mechanism .

How is recombinant Vaccinia virus Protein L1 typically expressed and purified for research purposes?

Recombinant L1 protein can be expressed in several systems, with each offering specific advantages:

E. coli Expression System:

  • The gene encoding residues 1-185 of L1 is typically amplified from genomic Vaccinia DNA and subcloned into an expression vector (e.g., pET21b) with a C-terminal hexahistidine tag .

  • Expression in E. coli BL21(DE3) cells yields L1 primarily in inclusion bodies, requiring solubilization and refolding .

  • Purification typically follows a three-step process:

    • Two rounds of immobilized metal affinity chromatography (IMAC)

    • Size-exclusion chromatography

    • Verification of proper folding by antibody binding assays

  • The typical yield is approximately 2 mg/L of bacterial culture .

Insect Cell Expression System:

  • Sf9 insect cells can be used to express L1 with N-terminal His and C-terminal myc tags .

  • This system often produces protein with more native-like post-translational modifications.

Expression in Mammalian Cells:

  • Recombinant vaccinia virus vectors can be used to express L1 in mammalian cells like HeLa .

  • This approach is particularly useful when studying L1 in the context of other viral proteins.

What methods are used to verify the proper folding and functionality of recombinant L1 protein?

Several approaches are used to confirm that recombinant L1 maintains its native structure and function:

Antibody Binding Assays:

  • ELISA using known anti-L1R antibodies (e.g., 7D11) can confirm proper folding .

  • A common approach involves sandwich ELISA with anti-poxvirus L1 antibody as capture and anti-His HRP antibody for detection .

Structural Analysis:

  • X-ray crystallography has been used to determine the structure of the L1 ectodomain at 1.51 Å resolution .

  • Hydrogen/deuterium exchange mass spectrometry can be used to examine conformational epitopes .

Functional Assays:

  • Neutralization assays with L1-specific antibodies can indirectly confirm functionality.

  • Cell binding assays can determine if the recombinant protein retains its ability to interact with cellular receptors.

How does L1 interact with other components of the entry fusion complex (EFC)?

The EFC is a multiprotein complex essential for vaccinia virus entry, with L1 playing a crucial role:

Components and Interactions:

  • The EFC comprises at least eight viral proteins (A16, A21, A28, G3, G9, H2, J5, and L5) plus associated proteins including L1 and F9 .

  • Coimmunoprecipitation experiments have demonstrated that L1 physically interacts with the EFC components and indirectly with F9 .

  • Unlike other EFC components, L1 and F9 are not required for the assembly or stability of the complex .

Functional Coordination:

  • L1 coordinates with other EFC proteins to facilitate a two-step viral entry process:

    • Initial attachment to cells (which L1-deficient virions can still perform)

    • Core penetration into the cytoplasm (which requires L1)

  • L1 also plays a role in membrane fusion events during viral entry .

What are the key epitopes on L1 protein targeted by neutralizing antibodies?

Studies have identified specific epitopes on L1 that are targets for potent neutralizing antibodies:

Critical Epitope Characteristics:

  • A conformational epitope with Asp35 as the key residue has been identified as a common site of vulnerability for potent neutralization .

  • This epitope is recognized mainly by CDR1 and CDR2 of the antibody heavy chain, which are highly conserved among neutralizing antibodies .

  • The antibodies targeting this epitope can neutralize vaccinia virus in an isotype- and complement-independent manner .

Epitope Discovery Methods:

  • Several techniques have been employed to map these epitopes:

    • Isolation of neutralization escape mutants

    • Hydrogen/deuterium exchange mass spectrometry

    • X-ray crystallography of antibody-antigen complexes

Comparison of Neutralizing vs. Non-neutralizing Epitopes:

  • Monoclonal antibodies against L1 cluster into distinct epitope groups

  • Neutralizing antibodies bind to the recombinant L1 protein with significantly higher affinity than non-neutralizing antibodies

  • Neutralizing antibodies can also bind to intact virions, unlike some non-neutralizing antibodies

How does the absence of L1 affect viral replication and morphogenesis?

Studies using conditional null mutants have revealed surprising aspects of L1's role:

Effects on Virus Assembly:

  • Contrary to earlier reports, L1 is not required for virus assembly or morphogenesis .

  • Studies with inducible L1 expression systems (vL1Ri) showed that in the absence of L1, virus particles are still formed and are indistinguishable from wild-type by:

    • Transmission electron microscopy

    • Analysis of component polypeptides

    • Processing of other viral proteins (A17 and A3)

Effects on Infectivity:

  • L1-deficient virions (L1^(-)) can attach to cells but cores fail to penetrate into the cytoplasm .

  • Without L1, viruses cannot form plaques or produce infectious progeny .

  • L1^(-) viruses cannot induce membrane fusion following low-pH treatment, even though extracellular virus is produced .

What are the optimal conditions for expression, refolding, and purification of recombinant L1 protein from E. coli?

Detailed protocols have been established for obtaining properly folded, functional L1 protein:

Expression Optimization:

  • Vector construction: The open reading frame (ORF) containing residues 1-185 of L1 is optimal for expression, as it excludes the transmembrane domain .

  • E. coli strain: BL21(DE3) cells typically yield the best expression .

  • Induction conditions:

    • IPTG concentration: 1.0 mM

    • Temperature: 37°C

    • Duration: 4 hours

Refolding Protocol:

  • Solubilization of inclusion bodies with 6M guanidine hydrochloride

  • Dilution into refolding buffer containing:

    • 50 mM Tris (pH 8.0)

    • 0.5 M L-arginine

    • 5 mM reduced glutathione

    • 0.5 mM oxidized glutathione

    • 0.1% Triton X-100

  • Incubation at 4°C for 3-4 days with gentle stirring

Purification Strategy:

  • First IMAC: Ni-NTA resin with elution using imidazole gradient

  • Second IMAC: After dialysis to remove imidazole

  • Size-exclusion chromatography using Superdex 75 column

  • Verification of proper folding using antibody binding assays (e.g., ELISA with 7D11 antibody)

Yield and Quality Assessment:

  • Typical yield: approximately 2 mg/L of bacterial culture

  • Purity assessment: SDS-PAGE (typically >90% purity)

  • Functionality confirmation: Binding to known anti-L1R antibodies

How can L1 be incorporated into recombinant vaccinia virus vectors for vaccine development?

L1 has been included in multicomponent vaccines against orthopoxviruses, with several approaches for incorporation:

Vector Construction Methods:

  • Homologous recombination between poxviruses can be achieved by:

    • Coinfecting cells with two viruses

    • Infecting cells with one virus and transfecting with genomic DNA

    • Infecting with virus and transfecting with cloned DNA segments

Expression Strategies:

  • The L1 gene can be placed under control of various promoters:

    • Native vaccinia virus promoters (early/late)

    • T7 promoter with lac operator for inducible expression

    • Modified vaccinia virus Ankara (MVA) E/L-promoter for use in attenuated vectors

Targeting Strategies for Integration:

  • Common integration sites include:

    • Thymidine kinase (TK) locus

    • Deletion III (DelIII) locus in MVA vectors

    • Other non-essential regions of the genome

Stability Considerations:

  • Genetic stability of recombinant vaccinia viruses expressing foreign antigens can be enhanced by:

    • Avoiding canonical vaccinia transcription termination signals (T5NT)

    • Eliminating known instability motifs such as runs of G5 and C5

    • Optimizing codon usage for the expression system

What are the latest approaches for studying L1 interactions with neutralizing antibodies?

Advanced techniques are being employed to characterize L1-antibody interactions:

Structural Biology Approaches:

  • X-ray crystallography of L1-antibody complexes (e.g., L1/M12B9-Fab complex, PDB: 4U6H) has revealed key interaction sites .

  • Cryo-electron microscopy can provide structural insights into L1 in the context of the whole virion.

Mass Spectrometry-Based Methods:

  • Hydrogen/deuterium exchange mass spectrometry has been successfully used to map conformational epitopes on L1 .

  • Cross-linking mass spectrometry can identify interaction interfaces between L1 and antibodies.

Computational Approaches:

  • Molecular dynamics simulations can predict effects of mutations on antibody binding.

  • In silico epitope prediction has been used to identify potential neutralizing epitopes on L1.

Advanced Binding Analysis:

  • Surface plasmon resonance (SPR) to determine binding kinetics and affinity.

  • Bio-layer interferometry for real-time analysis of antibody-antigen interactions.

  • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters of binding.

How do mutations in L1 affect virus neutralization and potential for vaccine escape?

Understanding L1 mutations is critical for vaccine development and therapeutic strategies:

Key Neutralizing Epitopes:

  • The conformational epitope centered on Asp35 is a common site of vulnerability .

  • Mutations at this site can result in escape from neutralizing antibodies.

Escape Mutant Analysis:

  • Neutralization escape mutants have been isolated and characterized to map critical residues .

  • These studies have shown that single amino acid changes can significantly impact antibody binding and virus neutralization.

Conservation Analysis:

  • The N-terminal region of L1 is highly conserved across orthopoxviruses:

    • Only one amino acid difference between vaccinia and variola (smallpox) virus L1

    • Two amino acid differences between vaccinia and monkeypox virus L1

  • This conservation suggests constraints on mutation due to functional importance and presents an opportunity for broad-spectrum vaccines.

Impact on Vaccine Strategy:

  • Targeting multiple epitopes on L1 and including additional viral antigens can minimize the risk of escape.

  • Monitoring naturally occurring variations in L1 sequences across poxvirus isolates can help predict potential escape mutations.

Table 1: Properties of Recombinant Vaccinia Virus Protein L1 (VACWR088) Preparations

PropertyE. coli ExpressionInsect Cell (Sf9) ExpressionYeast Expression
Molecular Weight~21.3 kDa (residues 1-185)~26 kDa~21.3 kDa
Expression Region2-185 aaFull length with tags2-183 aa
TagsC-terminal 6xHisN-His, C-mycN-terminal 6xHis
Purity>85% by SDS-PAGE~90%>85% by SDS-PAGE
Typical Yield2 mg/L cultureNot specifiedNot specified
Storage Condition-20°C/-80°C-20°C-20°C/-80°C
BufferTris/PBS-based, 5-50% glycerol or lyophilizedNot specifiedNot specified
Shelf Life6 months (liquid), 12 months (lyophilized)Not specified6-12 months

Data compiled from sources , , ,

Table 2: Functional Characteristics of L1 Protein and L1-Deficient Viruses

CharacteristicL1-Containing Virus (L1⁺)L1-Deficient Virus (L1⁻)
Virus AssemblyNormalNormal
Virus MorphologyNormal mature virionsIndistinguishable from wild-type
Protein ProcessingNormal processing of A17 and A3Normal processing of A17 and A3
Cell AttachmentEfficientEfficient
Core PenetrationSuccessfulFailed
Plaque FormationForms plaquesUnable to form plaques
Infectious ProgenyProduces infectious progenyNo infectious progeny
Cell-Cell FusionForms syncytia after low pHNo syncytia formation
EFC Component IntegrationNormal levels of other EFC proteinsNormal levels of other EFC proteins

Data compiled from source

Table 3: Critical Epitopes in L1 Protein for Neutralizing Antibodies

Epitope FeatureCharacteristicsNeutralizing Capacity
Key ResidueAsp35Critical for neutralization
Epitope TypeConformationalHigher neutralizing capacity than linear epitopes
Antibody RecognitionMainly by CDR1 and CDR2 of heavy chainConserved recognition pattern
Antibody DiversityDivergent light-chain and heavy-chain CDR3 sequencesMultiple antibody lineages recognize same epitope
Neutralization MechanismIsotype- and complement-independentMore potent than antibodies requiring complement
Binding AffinitySignificantly higher affinity than non-neutralizing antibodiesCorrelates with neutralization potency
Virion BindingCan bind to intact virionsEssential for neutralization

Data compiled from sources ,

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.