Recombinant Vaccinia virus Protein L1 (MVA080R, ACAM3000_MVA_080)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Entry

L1 is a component of the Entry/Fusion Complex (EFC), which mediates vaccinia virus membrane fusion and core penetration into host cells :

  • Critical for post-attachment entry: L1-deficient virions attach to cells but fail to penetrate the cytoplasm .

  • Cooperative interaction: Physically associates with EFC proteins (A16, A21, A28, etc.) and indirectly with F9, forming a membrane-embedded entry apparatus .

  • Neutralization target: Potent monoclonal antibodies (e.g., 7D11, 2D5) bind conformational epitopes on L1, blocking viral core entry without inhibiting membrane lipid mixing .

Recombinant Vaccinia Virus Vectors

  • MVA platform: The attenuated MVA strain (e.g., ACAM3000 derivatives) is a safe vector for recombinant vaccines due to its host-restricted replication and robust antigen expression .

  • Antigen design:

    • Recombinant L1 expressed in MVA retains native conformation, eliciting neutralizing antibodies and cytotoxic T-cell responses .

    • Prefusion-stabilized designs (e.g., MVA-Spf) enhance immunogenicity compared to wild-type constructs .

Clinical and Preclinical Findings

StudyKey ResultsReference
L1R(185t) immunizationInduces neutralizing antibodies in rabbits; MAbs block viral entry
MVA-Spf (SARS-CoV-2)Higher neutralizing antibody titers vs. non-stabilized S protein
HPV E6/E7 MVA vaccineSafe in Phase I/II trials; induces HPV-specific antibodies and CTLs
HIV gp160 MVA vaccineElicits gp160-specific antibodies and lymphoproliferative responses

Immune Response Mechanisms

  • Humoral immunity: Antibodies targeting L1’s disulfide-bonded loops neutralize infectivity by blocking core penetration .

  • Cellular immunity: Recombinant MVA vaccines prime CD8+ T-cell responses against co-expressed antigens (e.g., HIV, HPV) .

  • Prime-boost strategies: Combining MVA vectors with protein subunits enhances neutralizing antibody titers (e.g., HIV, SARS-CoV-2) .

Ongoing Research and Challenges

  • Structural optimization: Engineering prefusion-stabilized antigens (e.g., SARS-CoV-2 S) improves immunogenicity in MVA platforms .

  • Cross-protection: Polyvalent vaccines co-expressing multiple pathogen genes are under investigation .

  • Prior immunity: Preexisting vaccinia immunity may dampen responses, necessitating heterologous vector strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
MVA080R; ACAM3000_MVA_080; L1R; Protein L1; Virion membrane protein M25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-250
Protein Length
Full Length of Mature Protein
Species
Vaccinia virus (strain Ankara) (VACV)
Target Names
MVA080R
Target Protein Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAG TGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDMQN
Uniprot No.

Target Background

Function

This envelope protein likely plays a crucial role in viral entry into the host cell. It is probably involved in virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). It is essential for the fusion and penetration of the viral core into the host cell.

Protein Families
Chordopoxvirinae L1 family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of L1 protein in vaccinia virus?

    L1 (also called L1R) is a 250-residue myristoylated transmembrane protein expressed on the surface of the intracellular mature virion (IMV) form of vaccinia virus. The protein consists of a 185-residue disulfide-bonded ectodomain and a C-terminal hydrophobic segment embedded in the viral membrane. Structurally, L1's N-terminal region folds as a bundle of helices surrounding a pair of beta strands, with a hydrophobic cavity located adjacent to its N-terminus that can shield the myristate moiety . The protein is essential for both virion assembly and cellular entry. Notably, L1 is highly conserved throughout the poxvirus family and is nearly identical in vaccinia virus and variola virus (which causes smallpox) . Functionally, L1 serves as a receptor binding protein (RBP) that binds to cell surfaces independently of glycosaminoglycans (GAGs) .

  • Why is L1 protein significant as a vaccine target?

    L1 is a potent target for neutralizing antibodies and is critical for virus entry and infection. Studies have shown that monoclonal antibodies against L1 exhibit potent virus-neutralizing activity in plaque reduction assays and can diminish vaccinia virus-induced cell-cell fusion at low pH . Due to these characteristics, L1 has become a key component of several subunit vaccine candidates developed for protection against orthopoxvirus diseases . The protein's high conservation across the poxvirus family makes it particularly valuable, as vaccines targeting L1 may provide cross-protection against various poxviruses, including the deadly variola virus. L1 has demonstrated efficacy in both multi-gene DNA vaccines and multicomponent protein vaccines in animal models, blocking lethal viral challenge in mice and non-human primates .

  • How can researchers verify the proper folding of recombinantly expressed L1 protein?

    Proper folding of recombinant L1 protein can be verified using immunological methods that test binding to known anti-L1 antibodies. One established approach is to use an enzyme-linked immunosorbent assay (ELISA) with the following methodology:

    1. Coat ELISA plates with a known anti-poxvirus L1 antibody (such as 7D11) at 10 μg/mL and incubate overnight at 4°C

    2. Block plates with 5% milk in PBS

    3. Add L1R preparations at 100 μg/mL

    4. Detect bound L1R using anti-His horseradish peroxidase (if the recombinant protein has a His-tag)

    5. Develop with HRP substrate (such as ABTS) and read absorbance at 405 nm

    Strong binding to a characterized antibody like 7D11 indicates that the protein is intact and properly folded . Additional structural verification can be performed through circular dichroism spectroscopy or limited proteolysis to assess secondary structure elements and protein stability.

  • What are the basic expression systems for producing recombinant L1 protein?

    Recombinant L1 protein can be expressed in various systems, with E. coli being the most commonly documented. The typical methodology for E. coli expression includes:

    1. Cloning the L1R gene (commonly residues 1-185) into an expression vector like pET21b with a C-terminal hexahistidine tag

    2. Transforming the plasmid into BL21(DE3) or similar expression strains

    3. Inducing protein expression with IPTG when cultures reach appropriate density

    4. Recovering the protein from inclusion bodies through solubilization and refolding

    The typical yield is approximately 2 mg of purified protein per liter of bacterial culture . Alternative expression systems include insect cells using baculovirus vectors or mammalian cell expression, which may better preserve post-translational modifications like myristoylation but often yield lower protein amounts compared to bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.