Recombinant Vaccinia virus Protein L5 (L5R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
L5R; Protein L5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Target Names
L5R
Target Protein Sequence
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRK IPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR
Uniprot No.

Target Background

Function

The envelope protein of the entry-fusion complex. It mediates viral membrane fusion with the host cell membrane during viral entry and contributes to cell-cell fusion (syncytium formation).

Protein Families
Chordopoxvirinae L5 family
Subcellular Location
Virion membrane; Single-pass type III membrane protein.

Q&A

What is the L5 protein and what is its role in vaccinia virus?

L5 is a membrane protein encoded by the L5R gene of vaccinia virus, expressed following DNA replication with kinetics typical of viral late proteins. It functions as a critical component of the poxvirus cell entry/fusion apparatus . The protein contains a single intramolecular disulfide bond formed by the virus-encoded cytoplasmic redox pathway and is incorporated into intracellular mature virus particles, where it is exposed on the membrane surface . Experimental evidence demonstrates that L5 is essential for virus replication, as virions lacking L5 can bind to cells but fail to deliver viral cores into the cytoplasm . This makes L5 the fourth identified component of the poxvirus cell entry/fusion apparatus required for entry of both intracellular and extracellular infectious forms of vaccinia virus .

How conserved is the L5R gene among poxviruses?

The L5R gene is highly conserved among all sequenced members of the Poxviridae family, suggesting an important evolutionary role in virus replication . Multiple sequence alignment analyses including orthologs from each known genus of vertebrate and invertebrate poxviruses reveal two conserved cysteine residues across all L5 orthologs . Additionally, all L5R orthologs encode an N-terminal stretch of hydrophobic amino acids that functions as a transmembrane anchor . This high degree of conservation across diverse poxvirus genera strongly indicates that L5 serves a fundamental function in the poxvirus life cycle that has been maintained throughout poxvirus evolution.

What are the structural characteristics of the L5 protein?

The L5 protein has several key structural features:

  • Molecular weight: Approximately 15 kDa as determined by Western blotting

  • Membrane topology: Contains an N-terminal hydrophobic domain that functions as a transmembrane anchor

  • Disulfide bonding: Contains a single intramolecular disulfide bond formed by the virus-encoded cytoplasmic redox pathway

  • Surface exposure: The large C-terminal fragment is exposed on the surface of intracellular mature virions, while the smaller N-terminal segment remains beneath the membrane

  • Conserved elements: Contains two conserved cysteine residues that are present across all poxvirus L5 orthologs

Experiments using trypsin sensitivity and biotinylation with membrane-nonpermeating reagents confirm that the C-terminal portion of L5 is exposed on the virion surface, while the N-terminal domain is embedded in the viral membrane .

How can researchers create conditional lethal mutants of L5R for functional studies?

To create conditional lethal mutants of L5R, researchers can employ the following methodology based on established protocols:

  • Design a recombinant construct where the L5R open reading frame (ORF) is placed under the control of a bacteriophage T7 promoter and an Escherichia coli lac operator .

  • Include the following elements in your viral construct:

    • The T7 DNA-dependent RNA polymerase gene regulated by a vaccinia virus late promoter and a lac operator

    • A constitutively expressed E. coli lac repressor

    • An epitope tag (e.g., V5) fused to the L5R ORF for detection purposes

    • A fluorescent marker gene (e.g., EGFP) under control of a synthetic early-late vaccinia virus promoter

  • Generate a PCR product encompassing the entire L5R ORF (nucleotides 79904 to 80290) under control of the regulatable promoter system .

  • Transfect the PCR product into cells infected with a parental virus containing the lac repressor gene .

  • Select recombinant viruses by plaque purification in the presence of the inducer (IPTG) .

This methodology allows tight regulation of L5 expression, enabling detailed functional studies of virus replication in both the presence and absence of the protein. In the absence of IPTG, the lac repressor binds to both operators and prevents L5 expression; when IPTG is added, repression is relieved and L5 is expressed .

What experimental approaches can detect the membrane localization and topology of L5?

Multiple complementary approaches can determine the membrane localization and topology of L5:

  • Detergent extraction analysis:

    • Treat purified virions with nonionic detergent (e.g., NP-40) with or without reducing agents

    • Analyze protein release via Western blotting

    • Results will show that some L5 is released with NP-40 alone, but dithiothreitol is required to release most of the protein, similar to other membrane proteins like L1

  • Protease protection assay:

    • Treat intact virions with trypsin

    • Analyze pellet and supernatant fractions by Western blotting

    • Expect partial digestion of surface-exposed domains while membrane-protected domains remain intact

    • Compare results before and after membrane disruption with detergents

  • Surface biotinylation:

    • Treat purified virions with membrane-nonpermeating biotinylation reagent (e.g., sulfo-NHS-SS-biotin)

    • Capture biotinylated proteins with neutravidin beads

    • Compare binding patterns of L5 with known surface proteins (e.g., D8) and core proteins (e.g., A10)

    • Expect L5 biotinylation patterns similar to other surface membrane proteins

These approaches collectively demonstrate that L5 is anchored in the viral membrane by its N-terminal hydrophobic domain, with the larger C-terminal fragment exposed on the virion surface .

How does L5 interact with other components of the poxvirus entry/fusion apparatus?

The comprehensive analysis of L5's role in the poxvirus entry/fusion apparatus should include investigation of its interactions with the other three known components: A21, A28, and H2. While the provided search results don't specifically detail these interactions, researchers should consider the following methodological approaches:

  • Co-immunoprecipitation studies:

    • Generate antibodies or use epitope-tagged versions of each protein

    • Perform pull-down assays to identify direct protein-protein interactions

    • Analyze results under various conditions (with/without cross-linking, detergent treatments)

  • Complementation assays:

    • Create conditional mutants for each component (A21, A28, H2, and L5)

    • Assess whether overexpression of one component can rescue defects in another

    • Analyze functional redundancy and interdependence

  • Structural studies:

    • Use cryo-electron microscopy to visualize the entry complex

    • Perform protein crystallography of purified components

    • Create computational models of potential interaction interfaces

The phenotypic similarity between L5R conditional lethal mutants and those of A21, A28, and H2 strongly suggests functional interactions within a conserved entry/fusion complex .

What are the optimal conditions for expressing and purifying recombinant L5 protein?

Based on established protocols for vaccinia virus proteins, researchers should consider the following methodological approach for L5 expression and purification:

  • Construct design:

    • Create a PCR product consisting of the entire L5R gene under control of its native promoter

    • Add an epitope tag (e.g., V5 or His-tag) to either the N- or C-terminus for detection and purification

    • Clone into an appropriate expression vector

  • Expression systems:

    • For vaccinia virus-based expression:

      • Infect appropriate cells (e.g., BS-C-1 or HeLa S3) with recombinant vaccinia virus

      • Collect cells 18-24 hours post-infection for maximum yield

    • For bacterial expression:

      • Clone into a pET or similar system with appropriate signal sequences

      • Express in E. coli strains optimized for disulfide bond formation

  • Purification protocol:

    • Lyse cells with appropriate buffers containing detergents (e.g., NP-40)

    • For membrane proteins like L5, consider solubilization with 1% NP-40 or similar non-ionic detergents

    • Purify using affinity chromatography based on the epitope tag

    • Include reducing agents only when necessary, as L5 contains a functionally important disulfide bond

  • Quality control:

    • Confirm purity by SDS-PAGE and Western blotting

    • Verify proper folding through functional assays

    • Test disulfide bond formation using non-reducing gels

The success of L5 purification will depend significantly on maintaining proper membrane protein folding and preserving the critical intramolecular disulfide bond .

How can researchers analyze the disulfide bonding pattern in L5?

To analyze the disulfide bonding pattern in L5, researchers should implement the following methodological workflow:

  • Non-reducing vs. reducing gel analysis:

    • Prepare protein samples in buffer with or without reducing agents (e.g., DTT, β-mercaptoethanol)

    • Run parallel SDS-PAGE gels under reducing and non-reducing conditions

    • Detect migration differences by Western blotting with L5-specific antibodies

  • Alkylation studies:

    • Treat infected cells or purified virions with membrane-permeable alkylating agents

    • Compare mobility shifts between reduced and non-reduced samples

    • Analyze by Western blotting to detect changes in electrophoretic mobility

  • Site-directed mutagenesis:

    • Create point mutations at each conserved cysteine residue in L5

    • Express mutant proteins and analyze their folding, stability, and function

    • Determine which cysteines are essential for proper disulfide bond formation

  • Mass spectrometry analysis:

    • Digest purified L5 protein under non-reducing conditions

    • Analyze peptide fragments by LC-MS/MS

    • Map disulfide-linked peptides to determine precise bonding patterns

These approaches will help identify the specific cysteine residues involved in the intramolecular disulfide bond and determine the significance of this bond for L5 structure and function.

What techniques can assess whether L5-deficient virions can undergo membrane fusion?

To evaluate the fusion capacity of L5-deficient virions, researchers should employ multiple complementary techniques:

  • Cell-cell fusion assays:

    • Fusion from within (FFWI):

      • Infect cells with L5-deficient virus (e.g., vV5-L5i without IPTG)

      • Briefly expose cells to low pH buffer (pH 5.0)

      • Quantify multinucleated cell formation by microscopy

    • Fusion from without (FFWO):

      • Bind large amounts of purified L5-deficient virions to cell surfaces

      • Expose to low pH buffer

      • Count syncytia formation

  • Virion-liposome fusion assays:

    • Label virion membranes with fluorescent lipids

    • Monitor lipid mixing between virions and liposomes upon pH reduction

    • Compare fusion rates between wild-type and L5-deficient virions

  • Electron microscopy:

    • Examine virus-cell interactions at various time points post-infection

    • Observe virus particle morphology at the cell surface and during entry

    • Quantify fusion events and core delivery into cytoplasm

  • Core entry assay:

    • Detect viral cores in the cytoplasm using antibodies against core proteins

    • Compare core delivery efficiency between wild-type and L5-deficient virions

    • Utilize confocal microscopy for quantitative analysis

Research data indicates that L5-deficient virions are unable to mediate low-pH-triggered cell-cell fusion from within or without, suggesting a critical role for L5 in the membrane fusion process required for viral entry .

What methods effectively assess the effect of L5 mutations on virus replication?

To comprehensively evaluate the impact of L5 mutations on virus replication, researchers should implement the following methodological approaches:

  • Plaque formation assays:

    • Create point mutations or deletions in the L5R gene

    • Assess plaque size and morphology under varying conditions

    • Quantify plaque reduction as a percentage compared to wild-type virus

    Virus TypePlaque Formation (%)
    Wild-type100
    vV5-L5i with IPTG100
    vV5-L5i without IPTG0.5
  • One-step growth analysis:

    • Infect cells at high multiplicity of infection (MOI)

    • Harvest cells and media at various time points

    • Quantify infectious virus production by plaque assay

  • Electron microscopy of virus morphogenesis:

    • Fix infected cells at various time points

    • Process for transmission electron microscopy

    • Assess all stages of morphogenesis for abnormalities

  • Fluorescence microscopy for cell-to-cell spread:

    • Utilize GFP-expressing recombinant viruses

    • Monitor spread of infection in real-time

    • Quantify the number and size of infection foci

  • Binding and entry assays:

    • Label purified virions (wild-type and mutant)

    • Measure binding to host cells

    • Track internalization and core delivery

Research has shown that while L5-deficient virions appear morphologically normal and can bind to cells, they fail to enter the cytoplasm and cannot mediate cell-cell fusion, resulting in a complete block of cell-to-cell virus spread and infectious virus production .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.