Recombinant Vaccinia virus Protein L5 (MVA084R, ACAM3000_MVA_084)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MVA084R; ACAM3000_MVA_084; Protein L5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Vaccinia virus (strain Ankara) (VACV)
Target Names
MVA084R
Target Protein Sequence
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFIVFILIYVFFRSELNMFFMPKRK IPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR
Uniprot No.

Target Background

Function

Envelope protein component of the entry-fusion complex. It mediates viral membrane fusion with the host cell membrane during viral entry and contributes to cell-cell fusion (syncytium formation).

Protein Families
Chordopoxvirinae L5 family
Subcellular Location
Virion membrane; Single-pass type III membrane protein.

Q&A

What is the structural organization of Vaccinia virus protein L5?

Vaccinia virus protein L5 is a 15-kDa protein with a distinctive structural organization. It contains an N-terminal hydrophobic domain that functions as a transmembrane anchor, along with two highly conserved cysteine residues that form an intramolecular disulfide bond essential for proper protein function. The protein adopts a membrane topology where the large C-terminal fragment is exposed on the surface of intracellular mature virions, while the smaller N-terminal segment remains beneath the membrane . This structural arrangement is critical for the protein's role in the viral entry process, as mutations or disruptions to this organization can result in non-infectious viral particles.

How is the L5 protein expressed during the viral life cycle?

The L5 protein displays expression kinetics typical of a viral late protein. Experiments using recombinant viruses with epitope-tagged L5 (vV5-L5) show that the protein is first detected at approximately 6 hours post-infection, with expression levels increasing until at least 24 hours post-infection. This expression pattern is completely dependent on viral DNA replication, as demonstrated by inhibition studies using 1-β-d-arabinofuranosylcytosine (AraC). When AraC is present to block viral DNA synthesis, L5 protein is not detected at all . The L5R gene is regulated by a late promoter, containing the consensus motif characteristic of vaccinia virus late genes. This temporal regulation ensures L5 is produced during the appropriate phase of the viral replication cycle when it's needed for virion assembly.

How is recombinant L5 protein typically produced for research purposes?

Recombinant vaccinia virus protein L5 can be produced using various expression systems, with E. coli being a common platform. For instance, full-length L5 protein (corresponding to amino acids 1-128) can be expressed with an N-terminal His-tag to facilitate purification . For functional studies, researchers have also expressed L5 in mammalian cells using transfection of plasmids containing the L5R gene under the control of its native promoter, modified with epitope tags (such as V5) to enable detection and purification. This approach is particularly useful when studying L5 in the context of vaccinia virus infection, as it allows for the evaluation of proper folding, disulfide bond formation, and membrane insertion in a more native environment .

What considerations are important when designing experiments to study L5 disulfide bond formation?

When designing experiments to study L5 disulfide bond formation, researchers should implement specialized techniques to differentiate between reduced and oxidized forms of the protein. A recommended methodological approach involves treating samples with membrane-permeable N-ethylmaleimide (NEM) to block free sulfhydryls, followed by reduction with dithiothreitol (DTT) and subsequent alkylation with 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS) . This sequential treatment creates a detectable mobility shift specifically in proteins containing disulfide bonds, as AMS only binds to cysteines that were originally in disulfide linkages.

To properly evaluate the role of the vaccinia virus-encoded redox pathway in L5 disulfide bond formation, researchers should utilize conditional mutant viruses such as vE10i, in which expression of the critical redox protein E10 can be regulated. Parallel infections with control viruses (e.g., vT7lacOI with unmodified E10) are essential for comparative analysis. When designing transfection experiments to study L5 independently, consider that overexpression may result in incomplete disulfide bond formation, as observed in previous studies where a minority of L5 remained reduced even in control infections . This experimental design allows for precise determination of the requirements for proper L5 folding and maturation.

How can researchers optimize the expression and purification of functional recombinant L5 protein?

Optimizing expression and purification of functional recombinant L5 requires careful consideration of several factors due to its membrane-associated nature and disulfide bond requirements. When expressing L5 in prokaryotic systems such as E. coli, researchers should select specialized strains designed for disulfide bond formation (such as Origami or SHuffle strains) or co-express thioredoxin-related proteins to facilitate proper folding. For optimal results, expression should be conducted at lower temperatures (16-20°C) to reduce inclusion body formation .

For purification of properly folded L5, a multi-step approach is recommended. Initial capture via His-tag affinity chromatography should be followed by size exclusion chromatography to separate properly folded monomers from aggregates. Due to L5's membrane association, researchers should include appropriate detergents (such as 0.1% NP-40) in all buffers to maintain protein solubility without disrupting structure . For functional studies, it's critical to verify disulfide bond formation using non-reducing SDS-PAGE or mass spectrometry. The success of purification should be validated by testing the ability of recombinant L5 to complement L5-deficient viruses in infectivity assays, confirming that the purified protein maintains its native conformation and activity.

What techniques are most effective for analyzing the membrane topology of L5 protein?

For analyzing L5 membrane topology, a combinatorial approach using multiple complementary techniques yields the most reliable results. Controlled proteolysis experiments provide valuable insights—treating intact virions with trypsin followed by Western blot analysis using antibodies against different regions of L5 can reveal which portions are exposed on the virion surface. In previous studies, this approach demonstrated that a ~6-kDa N-terminal fragment remained associated with the viral membrane after trypsin treatment, consistent with a model where this region is protected by the membrane while the larger C-terminal domain is exposed .

Surface biotinylation using membrane-impermeant reagents like sulfo-NHS-SS-biotin represents another powerful approach. This method selectively labels proteins or protein domains exposed on the virion surface. When comparing the biotinylation efficiency of L5 with known surface proteins (such as D8) and core proteins (such as A10), researchers can quantitatively assess L5's membrane orientation . For maximum confidence in topological mapping, researchers should complement these biochemical approaches with immunoelectron microscopy using antibodies against different L5 domains and with computational predictions of transmembrane regions. This multi-faceted strategy enables precise determination of protein orientation within the viral membrane, which is essential for understanding L5's role in viral entry.

How can researchers assess the requirement of L5 protein for vaccinia virus replication?

To rigorously assess L5's requirement for vaccinia virus replication, researchers should employ conditional-lethal mutant systems allowing controlled regulation of L5 expression. A proven methodology involves constructing recombinant viruses (such as vV5-L5i) where the L5R gene is placed under the control of a bacteriophage T7 promoter and an E. coli lac operator . This system requires co-expression of T7 RNA polymerase and the lac repressor, allowing L5 expression to be precisely regulated by isopropyl β-D-1-thiogalactopyranoside (IPTG).

For comprehensive functional assessment, researchers should conduct multiple complementary assays:

  • Plaque formation assays to evaluate cell-to-cell spread (comparing +/- IPTG conditions)

  • One-step growth curves to quantify production of infectious progeny

  • EGFP reporter visualization to track individual infected cells in the absence of IPTG

  • Western blot analysis to confirm L5 expression levels correlate with observed phenotypes

Using this approach, previous studies demonstrated that L5 is essential for vaccinia virus replication, with a 99.5% reduction in plaque formation and severely impaired infectious virus production in the absence of L5 expression . This experimental framework allows researchers to definitively establish the requirement for L5 while quantifying its impact on different stages of the viral life cycle.

What assays can effectively measure L5 protein's role in viral entry?

To effectively measure L5's role in viral entry, researchers should implement a sequential experimental approach that dissects individual steps of the entry process. Begin with binding assays using purified virions (with and without L5) labeled with a fluorescent marker, allowing quantification of virus attachment to target cells independent of entry. Follow this with core entry assays measuring the release of viral cores into the cytoplasm, which can be visualized by immunofluorescence microscopy using antibodies against core proteins such as A4 .

For quantitative assessment of fusion activity, two complementary assays are recommended:

Assay TypeMethodologyMeasured ParameterControl
Fusion from withoutBind virions to cells at 4°C, then lower pH and raise temperatureCell-cell fusion mediated by virionsL5-containing virions
Fusion from withinInfect cells with virus, allow late gene expression, then lower pHCell-cell fusion mediated by viral proteins in cell membraneInfections with L5-expressing virus

Previous research established that virions lacking L5 could bind to cells but failed to deliver cores into the cytoplasm and were unable to mediate low-pH-triggered cell-cell fusion either from within or without . This comprehensive assay panel allows precise characterization of which specific step in the entry process depends on L5 function.

How can researchers investigate interactions between L5 and other viral entry proteins?

To investigate interactions between L5 and other viral entry proteins (such as A21, A28, and H2), researchers should employ multiple complementary protein-protein interaction detection methods. Co-immunoprecipitation experiments represent a valuable starting point: researchers can use antibodies against L5 (or its epitope tag) to pull down protein complexes from infected cell lysates or solubilized virions, followed by Western blotting to detect interacting partners . For added specificity, crosslinking agents can be applied before lysis to capture transient interactions.

For more quantitative biophysical characterization, researchers should consider the following techniques:

  • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) to detect interactions in living cells

  • Surface plasmon resonance (SPR) with purified components to determine binding kinetics and affinity

  • Proximity ligation assays to visualize protein-protein interactions in situ

  • Genetic approaches using complementation analysis between different conditional mutants

When investigating protein complex formation, it's essential to compare wild-type conditions with those where expression of individual components is repressed. The phenotypic similarity between L5R, A21, A28, and H2 conditional lethal mutants suggests these proteins function together in the entry/fusion apparatus . Systematic mapping of these interactions will clarify the architecture and assembly of this essential viral machinery.

What are common challenges in producing conditional L5 mutants and how can they be addressed?

When producing conditional L5 mutants for functional studies, researchers commonly encounter several challenges. A frequent issue is incomplete repression of the target gene, resulting in residual L5 expression even in uninduced conditions. To address this, optimization of the repressor system is essential—using high-affinity lac repressor variants and including multiple operator sequences can improve stringency. Another approach is to introduce the repressor gene at high copy number or under a strong constitutive promoter to ensure sufficient repressor protein levels .

Another common challenge is the emergence of revertant viruses that bypass the conditional regulation. In previous studies with vV5-L5i, researchers observed approximately 0.5% "revertant" viruses that expressed GFP but formed large plaques without inducer . To mitigate this issue:

  • Include reporter genes (like EGFP) to facilitate identification of recombinant viruses

  • Perform multiple rounds of plaque purification (at least five, as described in previous protocols)

  • Verify all genomic rearrangements by PCR and sequencing of viral DNA

  • Minimize the number of passages of the conditional mutant stock

  • Prepare virus stocks under fully induced conditions to maintain selective pressure

Additionally, researchers should validate the specificity of the observed phenotype by constructing revertant viruses or by trans-complementation with plasmids expressing the wild-type L5 protein, ensuring that the phenotype is solely due to L5 deficiency and not to unintended effects on neighboring genes or regulatory elements.

How can researchers troubleshoot issues with L5 disulfide bond formation?

When troubleshooting issues with L5 disulfide bond formation, researchers should systematically evaluate each component of the redox machinery required for proper folding. If L5 remains predominantly in a reduced state during expression, first verify the function of the vaccinia virus-encoded redox pathway by testing expression of other disulfide-containing viral proteins such as L1 . Conducting parallel experiments with control viruses and E10R conditional mutants can help identify whether the issue is specific to L5 or represents a general dysfunction of the redox system.

For detection and quantification of disulfide bond formation, optimize the alkylation protocol by testing different reagent concentrations and incubation times. If the mobility shift between reduced and oxidized forms is subtle, consider alternative gel systems such as high-percentage acrylamide or gradient gels to improve resolution . When working with recombinant L5 expressed in heterologous systems, the absence of the viral redox machinery may result in improper folding. Consider co-expressing components of the vaccinia virus redox pathway (E10, A2.5, and G4) or using specialized E. coli strains engineered for disulfide bond formation.

If overexpression leads to incomplete disulfide bond formation, as observed in previous studies where a minority of L5 remained reduced even in control infections , optimize expression conditions by:

  • Reducing expression temperature

  • Using weaker promoters

  • Shortening induction times

  • Adding reducing agents like glutathione to the media

These adjustments can help ensure that the oxidative machinery is not overwhelmed by excessive protein production.

What strategies help overcome difficulties in detecting L5 protein in complex samples?

Detecting L5 protein in complex samples like infected cell lysates or purified virions can be challenging due to its relatively low abundance and membrane association. To overcome these difficulties, several optimization strategies are recommended. First, consider epitope tagging approaches—previous studies successfully employed V5 epitope tags fused to either the N-terminus or C-terminus of L5, enabling sensitive detection with commercial monoclonal antibodies . When designing such constructs, place the tag at the terminus least likely to interfere with function based on conservation analysis.

For enhancing detection sensitivity, implement the following protocol improvements:

  • Include membrane solubilization steps with appropriate detergents (NP-40 was effective in previous studies)

  • Combine detergent treatment with reducing agents (DTT) for complete extraction from virions

  • Use signal amplification systems such as enhanced chemiluminescence or fluorescent secondary antibodies

  • Consider concentration techniques such as immunoprecipitation before Western blotting

When analyzing L5 association with viral particles, sucrose gradient purification followed by fractionation can separate different viral forms and increase detection specificity . For surface-exposed L5, membrane-impermeable biotinylation reagents followed by neutravidin capture provides excellent sensitivity and specificity. Quantitative comparisons with other proteins of known abundance (such as D8 surface protein and A10 core protein) can help validate detection methods and provide internal controls .

What emerging technologies could advance understanding of L5 protein structure and function?

Emerging technologies with significant potential to advance L5 protein research include cryo-electron microscopy (cryo-EM) for structural determination of L5 within the viral membrane context. Unlike crystallography, which has limitations for membrane proteins, cryo-EM could reveal the three-dimensional organization of L5 relative to other entry complex components (A21, A28, and H2) in situ. Single-particle analysis combined with subtomogram averaging could achieve near-atomic resolution of the entire entry/fusion apparatus .

Another promising approach is hydrogen-deuterium exchange mass spectrometry (HDX-MS), which can map conformational changes in L5 during different stages of the entry process, potentially revealing how acidification triggers the fusion activity. For functional studies, advanced genome editing using CRISPR-Cas9 could generate cell lines expressing fluorescently tagged host receptors, enabling real-time visualization of L5-receptor interactions during viral entry.

Additionally, integrative structural biology approaches combining:

  • AlphaFold2 or RoseTTAFold predictions of L5 structure

  • Molecular dynamics simulations of membrane insertion

  • Experimental validation with crosslinking mass spectrometry

  • Electron paramagnetic resonance spectroscopy for dynamics

These technologies could collectively elucidate how L5 transitions between pre-fusion and post-fusion conformations, providing mechanistic insights currently unobtainable through conventional methods.

How might research on L5 inform development of poxvirus-based vaccines and therapeutics?

Research on L5 has significant implications for poxvirus-based vaccine and therapeutic development, particularly since L5 is essential for viral entry and conserved across all members of the Poxviridae family . Understanding the structural and functional aspects of L5 could enable rational design of attenuated vaccine vectors with modified entry characteristics, potentially improving safety profiles while maintaining immunogenicity.

The absolute requirement of L5 for viral infectivity makes it an attractive target for antiviral development. Small molecule inhibitors specifically targeting the L5 protein could block poxvirus entry without affecting host cellular functions, potentially offering high specificity and low toxicity. Given that L5 participates in a multi-protein entry/fusion complex with A21, A28, and H2, compounds disrupting these protein-protein interactions represent another promising therapeutic avenue .

For vaccine development, recombinant L5 protein could be incorporated into subunit vaccines to elicit neutralizing antibodies targeting the entry process. Previous research demonstrating that L5 is exposed on the virion surface and contains disulfide bonds essential for function suggests that antibodies recognizing conformational epitopes on L5 might effectively neutralize virus infectivity . Furthermore, understanding how L5 contributes to host cell tropism could inform the engineering of oncolytic poxviruses with enhanced specificity for cancer cells through modifications to the entry complex.

What aspects of L5 protein function remain poorly understood and require further investigation?

Despite significant advances in understanding L5 protein, several critical aspects remain poorly characterized and warrant further investigation. The precise molecular mechanism by which L5 mediates membrane fusion remains unclear. While we know L5 is required for entry and functions alongside A21, A28, and H2, the specific conformational changes these proteins undergo during fusion have not been elucidated . Research should focus on determining whether L5 directly participates in membrane merger or plays a regulatory role in activating other fusion proteins.

The potential interaction of L5 with host cell receptors represents another significant knowledge gap. Questions include:

  • Does L5 bind directly to specific host factors?

  • How do these interactions differ between cell types, potentially explaining tissue tropism?

  • What is the temporal sequence of protein complex assembly during entry?

  • How does acidification trigger conformational changes in the entry complex?

Additionally, while research has established that L5 contains an intramolecular disulfide bond formed by the virus-encoded redox pathway , the structural consequences of this bond remain unknown. More detailed structural studies are needed to determine how disulfide formation affects L5 conformation and whether it undergoes redox-dependent structural transitions during the entry process. Finally, the evolutionary conservation of L5 across poxviruses suggests essential functionality, yet how variations in L5 sequence between different poxvirus genera might contribute to host range determination remains an open question requiring comparative functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.