Recombinant Vaccinia virus Protein L5 (VACWR092)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VACWR092; L5R; Protein L5; Protein F6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR092
Target Protein Sequence
MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRK IPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR
Uniprot No.

Target Background

Function
This envelope protein is part of the entry-fusion complex, mediating viral membrane fusion with the host cell membrane during viral entry. It also likely plays a role in cell-cell fusion (syncytium formation).
Gene References Into Functions
  1. Further evidence supporting the specific interaction between G3 and L5 was obtained via mass spectrometry. PMID: 21295816
Database Links

KEGG: vg:3707548

Protein Families
Chordopoxvirinae L5 family
Subcellular Location
Virion membrane; Single-pass type III membrane protein.

Q&A

What is the basic structure and localization of Vaccinia virus Protein L5?

L5 is a 15 kDa protein encoded by the L5R gene (VACWR092) of vaccinia virus. The protein contains an N-terminal hydrophobic domain that functions as a transmembrane anchor, with the larger C-terminal fragment exposed on the surface of the intracellular mature virions (IMVs). L5 contains two conserved cysteine residues that form an intramolecular disulfide bond rather than intermolecular bonds . The protein is anchored in the viral membrane with its C-terminal portion accessible on the virion surface, as demonstrated by trypsin sensitivity assays and biotinylation experiments with membrane-nonpermeating reagents . This membrane topology is critical for its function in viral entry into host cells.

When during the viral replication cycle is L5 expressed?

L5 is synthesized with the kinetics of a typical late protein, with expression occurring after viral DNA replication . In experimental systems using a V5 epitope-tagged version of L5, the protein can be detected at approximately 6 hours post-infection and continues to accumulate until at least 24 hours post-infection . The expression of L5 is prevented when viral DNA replication is inhibited with 1-β-d-arabinofuranosylcytosine (AraC), confirming its classification as a late viral protein . This expression pattern is consistent with the presence of a late promoter consensus motif in the sequence upstream of the L5R open reading frame.

What is the evolutionary conservation pattern of L5 across the Poxviridae family?

The L5R gene is remarkably conserved among all sequenced members of the Poxviridae family, including both vertebrate and invertebrate poxviruses . Multiple sequence alignment analysis reveals that L5R orthologs across different poxvirus genera consistently encode two conserved cysteine residues and an N-terminal hydrophobic domain that likely functions as a transmembrane anchor . This high degree of conservation across diverse poxviruses strongly suggests that L5 plays a fundamental role in the viral life cycle that has been maintained throughout poxvirus evolution.

How does the formation of disulfide bonds in L5 relate to the vaccinia virus redox pathway?

The intramolecular disulfide bond in L5 is formed through the vaccinia virus-encoded cytoplasmic redox pathway . This pathway involves three viral oxidoreductases: E10, A2.5, and G4, which act in series to promote disulfide bond formation within cytoplasmic domains of several IMV membrane proteins . Experimental evidence using conditional-lethal virus mutants demonstrates that in the absence of E10 expression, L5 remains completely reduced with no disulfide bond formation . This can be visualized using alkylation assays with 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS), which causes a mobility shift of approximately 1 kDa when both cysteines are reduced but no significant shift when the intramolecular disulfide is formed . This relationship between L5 and the viral redox pathway highlights the coordinated nature of post-translational modifications in poxvirus membrane proteins.

What evidence supports the role of L5 in viral entry and membrane fusion?

L5 has been identified as the fourth component of the poxvirus cell entry/fusion apparatus, alongside A21, A28, and H2 proteins . The evidence supporting this role comes from conditional-lethal mutant studies where L5 expression was regulated by an IPTG-inducible system. In the absence of L5:

  • Virions could bind to cells but viral cores failed to enter the cytoplasm

  • Non-infectious virions were unable to mediate low-pH-triggered cell-cell fusion from within or without

  • Cell-to-cell virus spread was inhibited, resulting in isolated infected cells unable to spread infection

  • The formation of infectious progeny virions was dramatically reduced (99.5% decrease in plaque formation)

Most notably, the phenotype of L5 conditional mutants precisely matches those of previously described mutants in A21, A28, and H2 genes, indicating they function in the same pathway or complex involved in virus entry .

What methodological approaches have been most successful for studying L5 membrane topology?

Two complementary approaches have proven particularly effective for analyzing L5 membrane topology:

  • Protease accessibility assays: Treatment of purified IMVs with trypsin results in partial digestion of L5, producing a ~6 kDa cleavage product that remains associated with the viral membrane . This fragment corresponds to the V5-tagged N-terminal segment containing the transmembrane domain. The incomplete digestion suggests partial accessibility of the trypsin cleavage site on the virion surface .

  • Selective biotinylation: Using membrane-nonpermeating biotinylation reagents such as sulfo-NHS-SS-biotin that react specifically with primary amines on surface-exposed proteins. In experiments with purified virions, L5 was efficiently biotinylated at levels comparable to known surface membrane proteins (like D8) and at significantly higher levels than core proteins (like A10) . This provides strong evidence that substantial portions of L5 are exposed on the virion surface.

These complementary approaches have collectively established that L5 adopts a specific orientation in the viral membrane with its C-terminal domain exposed on the virion surface, providing important structural insights relevant to its function in viral entry.

How can recombinant vaccinia viruses with regulated L5 expression be constructed?

The construction of conditional-lethal vaccinia virus mutants for studying L5 function involves several key steps:

  • Design of the expression cassette: Create a PCR product encompassing the entire L5R open reading frame under the control of a bacteriophage T7 promoter regulated by an E. coli lac operator, with an adjacent reporter gene (such as EGFP) under control of a vaccinia virus synthetic early-late promoter .

  • Homologous recombination: Incorporate approximately 650 bp flanking sequences on both termini of the PCR product to ensure efficient homologous recombination into the viral genome .

  • Transfection and selection: Infect BS-C-1 cells with a parental virus containing the T7 RNA polymerase and E. coli lac repressor genes, then transfect with the purified PCR product. Harvest infected cells after 24 hours and subject them to freeze-thaw cycles .

  • Plaque purification: Isolate viral plaques exhibiting EGFP expression in the presence of IPTG through multiple rounds of plaque purification .

  • Verification: Confirm genomic rearrangements by PCR and sequencing of viral DNA to ensure proper integration of the regulated L5R gene .

This methodology has successfully generated the vV5-L5i conditional mutant virus that requires IPTG for L5 expression, providing a valuable tool for studying L5 function through controlled expression .

What biochemical assays can be used to determine the disulfide bond status of L5?

Several complementary biochemical approaches can be employed to determine the disulfide bond status of L5:

  • Comparative gel electrophoresis: Compare the electrophoretic mobility of L5 under reduced and non-reduced conditions. The absence of significant mobility differences between these conditions indicates the disulfide bond is intramolecular rather than intermolecular .

  • Alkylation with mass-altering reagents: Treat cell lysates containing L5 with alkylating agents that selectively modify free sulfhydryl groups:

    • N-ethylmaleimide (NEM): Adds 0.125 kDa per reactive cysteine

    • 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS): Adds 0.536 kDa per reactive cysteine

  • Reduction followed by alkylation: First reduce proteins with Tris-(2-carboxyethyl)phosphine (TCEP) to break disulfide bonds, then alkylate with AMS. The resulting mobility shift (~1 kDa for L5) indicates the presence of two cysteines that were previously involved in a disulfide bond .

  • Controls with redox pathway mutants: Perform the above assays in cells infected with conditional mutants defective in the viral redox pathway (such as vE10i) to confirm the dependence of L5 disulfide formation on specific viral components .

This combination of approaches provides robust evidence for the presence and nature of disulfide bonds in the L5 protein.

What methods are effective for analyzing the incorporation of L5 into mature virions?

To analyze the incorporation of L5 into mature virions, researchers can employ several complementary approaches:

  • Virion purification: Amplify virus in infected cells (with or without IPTG for conditional mutants), then purify intracellular mature virions through sedimentation through two sucrose cushions and one sucrose gradient . Verify purity by electron microscopy and SDS-PAGE.

  • Differential extraction: Treat purified virions with increasing strengths of extraction conditions:

    • Buffer alone (control)

    • Non-ionic detergent (NP-40)

    • NP-40 plus reducing agent (DTT)

  • Western blot analysis: Analyze pellet and supernatant fractions by SDS-PAGE and Western blotting with antibodies against the epitope tag on L5 (e.g., V5) and compare extraction patterns with known virion proteins (e.g., L1 for membrane proteins, A10 for core proteins) .

  • Quantification: Determine the relative amounts of L5 in different virion fractions and compare with the distribution patterns of known virion proteins to establish the membrane association characteristics of L5 .

These approaches have demonstrated that L5 behaves similarly to other intracellular mature virion membrane proteins, requiring both detergent and reducing conditions for complete extraction from purified virions .

How should researchers distinguish between direct and indirect effects when analyzing L5 conditional mutant phenotypes?

When analyzing the phenotypes of L5 conditional mutants, researchers must carefully distinguish between direct effects of L5 absence and potential indirect consequences. Consider the following approaches:

  • Temporal analysis: Examine multiple time points after infection to determine which defects appear first, potentially indicating direct effects of L5 deficiency .

  • Morphological assessment: Use electron microscopy to examine all stages of virion morphogenesis in the absence of L5 to determine which specific steps are affected . The search results indicate that virions lacking L5 appeared morphologically normal despite being non-infectious.

  • Complementation studies: Express L5 from a transfected plasmid in cells infected with the L5-deficient virus to confirm that observed defects are directly attributable to L5 absence .

  • Comparative analysis: Compare the phenotypes of L5 conditional mutants with mutants in other genes involved in similar processes (like A21, A28, and H2) to identify common versus unique effects . In the case of L5, the identical phenotypes observed across these four mutants strongly suggest they function in the same pathway.

  • Biochemical interaction studies: Perform co-immunoprecipitation or proximity labeling experiments to identify direct binding partners of L5, which can help establish direct functional relationships .

This multifaceted approach helps researchers avoid misattributing secondary effects to direct functions of the L5 protein.

What controls are essential when analyzing L5 expression and incorporation into virions?

When studying L5 expression and virion incorporation, several critical controls are essential:

Control TypePurposeImplementation
Temporal controlsVerify expression kineticsInclude time course samples from early to late infection phases (0-24h)
DNA replication controlsConfirm late gene classificationInclude samples with DNA replication inhibitors (e.g., AraC)
Protein modification controlsAssess disulfide bond formationInclude reduced/non-reduced samples and appropriate alkylation controls
Localization controlsValidate membrane associationInclude known membrane proteins (e.g., L1, D8) and core proteins (e.g., A10)
Conditional expression controlsVerify regulated expressionInclude samples with and without inducer (IPTG), and parental virus controls
Extraction controlsDetermine protein solubilityInclude buffer-only, detergent, and detergent+reducing agent conditions
Surface exposure controlsValidate topologyInclude membrane-impermeable reagents and control proteins with known topologies

How can researchers quantitatively assess the impact of L5 on virus infectivity and spread?

Quantitative assessment of L5's impact on virus infectivity and spread requires multiple complementary approaches:

  • Plaque formation assay: Compare plaque numbers and sizes between L5-expressing and L5-deficient conditions. The research shows a 99.5% reduction in plaque formation in the absence of L5 expression .

  • Single-step growth curve analysis: Infect cells at high multiplicity of infection (MOI) with conditional L5 mutants in the presence or absence of inducer, then harvest at different time points to quantify infectious virus production over time .

  • Fluorescence microscopy: Utilize reporter genes (like EGFP) to visualize the extent of virus spread. The L5 conditional mutant (vV5-L5i) demonstrated isolated EGFP-positive cells in the absence of IPTG, indicating a failure in cell-to-cell spread .

  • Particle-to-PFU ratio determination: Measure the ratio between physical particles (by optical density at 260 nm) and infectious units (by plaque assay) to quantify the proportion of virions that are infectious .

  • Entry assays: Develop quantitative assays to measure core entry into the cytoplasm, such as tracking fluorescently labeled cores or measuring early gene expression as a proxy for successful entry .

These quantitative approaches provide complementary data on the specific steps in the viral life cycle that depend on L5, enabling researchers to precisely define its functional contributions to infectivity and spread.

What approaches might reveal the molecular mechanism of L5's role in membrane fusion?

Several advanced approaches could elucidate the precise molecular mechanism of L5's role in membrane fusion:

  • Structural biology: Determine the three-dimensional structure of L5 alone and in complex with other entry/fusion components (A21, A28, and H2) using cryo-electron microscopy or X-ray crystallography. This would provide insights into how these proteins collectively mediate membrane fusion .

  • Site-directed mutagenesis: Systematically mutate conserved residues in L5, particularly the cysteine residues involved in disulfide bond formation, to identify specific amino acids critical for fusion activity .

  • Real-time fusion assays: Develop fluorescence-based assays to visualize membrane fusion events in real-time, comparing wild-type virus with conditional L5 mutants to determine the precise stage at which fusion is blocked .

  • Interaction mapping: Use hydrogen-deuterium exchange mass spectrometry or crosslinking mass spectrometry to map the interfaces between L5 and other components of the entry/fusion apparatus, as well as potential interactions with host cell receptors .

  • Single-particle tracking: Employ super-resolution microscopy to track individual virions during the entry process, comparing the dynamics of L5-containing and L5-deficient particles to identify specific differences in membrane interaction or fusion events .

These approaches would significantly advance our understanding of how L5 contributes to the complex process of poxvirus entry and membrane fusion.

How might the disulfide bond in L5 contribute to its function in viral entry?

The intramolecular disulfide bond in L5 likely plays a crucial role in its function during viral entry. Future research could investigate this relationship through:

  • Redox-switchable mutants: Create L5 variants with engineered disulfide bonds that can be controlled through external redox conditions to test whether dynamic changes in disulfide status correlate with fusion activity .

  • Disulfide mapping: Precisely determine which cysteines form the intramolecular disulfide bond and how this affects protein conformation using mass spectrometry-based approaches .

  • Kinetic analysis: Study the timing of disulfide bond formation in L5 relative to virion assembly and entry to determine if redox changes during entry might trigger conformational changes required for fusion .

  • Comparative analysis: Compare the disulfide bond patterns and requirements across different poxvirus L5 orthologs to identify evolutionarily conserved features of redox regulation .

  • Fusion trigger investigation: Determine whether low pH or other fusion triggers induce conformational changes in L5 that depend on its disulfide bond status, potentially revealing how environmental cues are transduced into membrane fusion events .

These studies would provide mechanistic insights into how post-translational modifications of L5 contribute to the complex process of poxvirus entry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.