Recombinant Vaccinia virus Viral replication protein A28 (VACWR151)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Entry and Fusion

A28 is indispensable for vaccinia virus replication and EFC assembly. Key findings include:

  • EFC interactions: Forms a 1:1 subcomplex with H2 protein; alanine mutagenesis identified residues critical for this interaction (e.g., D61, V62, D63) .

  • Membrane fusion: Mutations in regions I (RI: residues 59–72) disrupt EFC formation and reduce infectivity by >90%, while regions II (RII) and III (RIII) show lesser impacts .

  • Thermal stability: Truncated A28 (Δ133–146) lacking the α3 helix and one disulfide bond loses function at 39°C, highlighting structural dependencies .

Key Mutagenesis Findings

Mutant RegionFunctional ImpactInfectivity Reduction
RI (D61V/V62N/D63D)Disrupted H2 binding and EFC assembly>90%
G90A (conserved)Impaired EFC formation~70%
RII (residues 91–105)Minimal effect on infectivity<20%

Recombinant Expression Systems

Recombinant A28 has been expressed in diverse systems for functional and immunological studies:

  • Baculovirus/insect cells: Secreted soluble A28 (rA28) with melittin signal peptide and C-terminal His-tag induced neutralizing antibodies in rabbits, conferring murine protection against vaccinia challenge .

  • E. coli: Full-length A28 (1–146 aa) with N-terminal His-tag expressed for biochemical assays .

  • Vaccinia-based vectors: Epitope-tagged A28 (e.g., HA-tagged vA28-HA) used to study synthesis kinetics, confirming late-stage expression during viral replication .

Recombinant Construct Comparison

Expression SystemTag/ModificationApplicationSource
Insect cellsC-terminal His-tagAntibody generation
E. coliN-terminal His-tagStructural/functional studies
Vaccinia virusHA epitope tagLocalization and kinetics

Applications in Research and Therapeutics

  • Vaccine development: Recombinant A28 elicits neutralizing antibodies, suggesting utility in subunit vaccines against poxviruses .

  • Mechanistic studies: Truncated A28 variants enable structural insights into EFC assembly and fusion mechanisms .

  • Antiviral targets: Residues critical for H2 binding (e.g., RI region) represent potential sites for small-molecule inhibition .

Future Directions

Ongoing research focuses on:

  • High-resolution structural analysis of full-length A28 in membrane contexts.

  • Functional characterization of A28 orthologs in pathogenic orthopoxviruses (e.g., mpox, smallpox) .

  • Development of A28-targeted therapeutics leveraging mutagenesis data .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VACWR151; A28L; Envelope protein A28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Target Names
VACWR151
Target Protein Sequence
MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL
Uniprot No.

Target Background

Function
The envelope protein is crucial for viral entry into the host cell and for cell-cell fusion (syncytium formation).
Protein Families
Poxviridae A28 protein family
Subcellular Location
Virion membrane; Single-pass type III membrane protein. Note=Component of the mature virion (MV) membrane.

Q&A

What is the A28 protein and what is its role in vaccinia virus?

The A28 protein is encoded by the A28L gene (VACWR151) of vaccinia virus and produces a 16.3 kDa protein that serves as an essential component of the virus life cycle . It functions as a membrane protein of the intracellular mature virion (IMV) and is critically involved in virus entry and membrane fusion processes. A28 is part of the Entry/Fusion Complex (EFC), which consists of at least eight transmembrane proteins that are conserved across all poxviruses . Without functional A28 protein, vaccinia virus cannot successfully enter host cells, making it an essential viral factor. The protein's importance is underscored by its high conservation among poxviruses, suggesting an evolutionarily preserved role in the viral replication machinery.

When is the A28 protein expressed during the vaccinia virus replication cycle?

The A28 protein is expressed at late times during the vaccinia virus replication cycle, consistent with its role in virion assembly and structure . The start codon of the A28L open reading frame (ORF) forms part of a TAAATG sequence, which is characteristic of promoters of late genes in poxviruses . Experimental evidence supporting its late expression comes from studies using vA28-HA, a recombinant vaccinia virus with an influenza hemagglutinin (HA) epitope tag attached to the A28 protein. When cells were infected with vA28-HA in the presence of cytosine arabinoside (AraC), an inhibitor of DNA replication, the amount of A28-HA did not increase above background levels. This confirms that A28 is a late protein since viral DNA replication is required for late gene expression . The timing of expression approximately 4 hours post-infection coincides with the typical onset of viral late-protein synthesis in the vaccinia replication cycle.

What is the structural organization of the A28 protein?

The A28 protein has a distinctive structural organization that reflects its function as a membrane component of the vaccinia virion. It possesses an N-terminal hydrophobic sequence that anchors the protein in the virion surface membrane, with most of the protein exposed to the cytoplasm . The cytoplasmic domain contains four conserved cysteine residues that form two intramolecular disulfide bonds, which are essential for protein function . These disulfide bonds are unusual since they form in the reducing environment of the cytoplasm, requiring a specialized viral redox pathway. The protein has a molecular weight of approximately 16.3 kDa but appears as bands of 17 kDa (likely the monomeric form) and 24-27 kDa (possibly modified forms) when analyzed by SDS-PAGE under non-reducing conditions . When the A28 protein is subjected to reducing conditions, the migration pattern changes due to the reduction of disulfide bonds, confirming their presence in the native protein structure.

How does the A28 protein interact with other components of the viral entry/fusion complex?

The A28 protein functions as one of at least eight proteins that make up the Entry/Fusion Complex (EFC) of vaccinia virus, which mediates viral entry and membrane fusion . While the complete physical structure and precise interactions within the EFC have not been fully determined, research indicates that A28 is one of the first identified components of this complex along with the H2 protein . The interactions between A28 and other EFC proteins are likely mediated through specific domains, potentially including the disulfide-bonded regions in the cytoplasmic portion of the protein. The formation of proper disulfide bonds in A28 depends on the expression of three viral proteins—E10, A2.5, and G4—which together comprise a conserved cytoplasmic redox pathway . This dependency suggests that correct protein folding and disulfide bond formation in A28 are prerequisites for assembly into the functional EFC. The interdependence of these proteins explains why defects in any of the EFC components or the redox pathway can impair viral entry and infectivity.

What approaches are used to create recombinant versions of the A28 protein for immunological studies?

Creating recombinant versions of the A28 protein for immunological studies involves several sophisticated approaches. One effective method is to generate soluble forms by replacing the transmembrane domain with a signal peptide and adding a polyhistidine tail to facilitate purification . In practice, this involves PCR amplification of the A28L ORF with primers that incorporate the desired modifications, followed by insertion into appropriate expression vectors. For baculovirus expression systems, the modified gene is cloned into a transfer vector and then integrated into the baculovirus genome through homologous recombination in insect cells . After expression, the recombinant protein is secreted into the medium and can be purified using affinity chromatography with nickel columns that bind the polyhistidine tag.

For viral expression systems, researchers have constructed recombinant vaccinia viruses (like vA28-HA) by attaching sequences encoding epitope tags (such as the influenza hemagglutinin epitope) to the 3' terminus of the A28L gene . This approach involves recombinant PCR to assemble DNA segments containing the A28L gene with the epitope tag sequence, followed by a marker gene (such as E. coli β-glucuronidase) under a vaccinia virus promoter. The final PCR product is transfected into infected cells where homologous recombination occurs, allowing selection of recombinant viruses through marker expression . For inducible systems, the A28L gene can be placed under the control of regulatable promoters, such as the IPTG-inducible T7 promoter system, enabling controlled expression for functional studies .

How can conditional-lethal recombinant vaccinia viruses with inducible A28L genes be constructed and utilized?

Construction of conditional-lethal recombinant vaccinia viruses with inducible A28L genes represents an advanced experimental approach for studying essential viral proteins. This method begins with a parental virus strain containing an inducible system, such as vT7lacOI, which has an IPTG-inducible bacteriophage T7 RNA polymerase gene . The A28L gene is then placed under the control of a T7 promoter through homologous recombination. This creates a virus strain where A28 expression depends on the presence of the inducer molecule (IPTG).

The construction process typically involves several steps: (1) designing a transfer vector containing the A28L gene under a T7 promoter, (2) incorporating flanking viral DNA sequences for homologous recombination, (3) including a selection marker for identifying recombinant viruses, (4) transfecting the construct into cells infected with the parental virus, and (5) selecting and purifying the resultant recombinant viruses . For verification, researchers confirm the construct through PCR, sequencing, and functional assays.

These conditional mutants are invaluable research tools that allow precise investigation of A28's role in the viral life cycle. In the presence of the inducer, the virus replicates normally; upon withdrawal, A28 protein synthesis stops, and only preformed protein remains. This enables researchers to determine exactly when A28 functions during infection and what happens when it's absent. Such viruses can be used to study protein stability, turnover rates, temporal requirements for activity, and interactions with other viral or cellular components. Additionally, they provide platforms for testing potential antivirals that might target A28 function or interactions.

What methods are most effective for analyzing the disulfide bond formation in the A28 protein?

Analyzing disulfide bond formation in the A28 protein requires specialized biochemical techniques due to the unusual nature of these bonds forming in a normally reducing cytoplasmic environment. The most effective analytical approach combines multiple complementary methods to provide comprehensive characterization.

SDS-PAGE under non-reducing versus reducing conditions is the foundational technique for detecting disulfide bonds. When A28 protein samples are prepared without reducing agents and analyzed by SDS-PAGE, the intramolecular disulfide bonds remain intact, resulting in a more compact protein structure that migrates faster than would be predicted by molecular weight alone . Upon addition of reducing agents like dithiothreitol (DTT) or β-mercaptoethanol, the disulfide bonds break, causing a mobility shift to an apparently higher molecular weight. This characteristic shift provides initial evidence for the presence of disulfide bonds.

For precise mapping of disulfide bonds, mass spectrometry following protease digestion offers the highest resolution. Samples are digested with proteases in non-reducing conditions, preserving disulfide-linked peptides that can be identified by their unique mass signatures. Comparing these results with samples digested under reducing conditions reveals which cysteine residues are linked.

Site-directed mutagenesis provides functional confirmation by systematically replacing cysteine residues with serine (which cannot form disulfide bonds) and assessing the impact on protein function and structure. For example, replacing the four conserved cysteines in A28 would determine which are essential for proper folding and activity.

To study the dependence of A28 disulfide bond formation on the viral redox pathway, transfection experiments with A28 expression plasmids into cells infected with vaccinia virus mutants lacking components of the pathway (E10, A2.5, or G4) can be performed . Analysis of A28's oxidation state in these different backgrounds reveals which pathway components are necessary for proper disulfide bond formation.

What techniques can be used to identify and characterize T cell epitopes of the A28 protein?

Identifying and characterizing T cell epitopes of the A28 protein involves a systematic approach combining computational prediction with experimental validation. The process typically begins with in silico epitope prediction using algorithms that analyze the protein sequence for potential MHC-binding peptides. These algorithms consider parameters such as amino acid sequence, predicted binding affinity to specific MHC molecules, and proteasomal processing.

For experimental validation, researchers employ peptide library screening, where overlapping synthetic peptides spanning the entire A28 sequence are tested for their ability to stimulate T cell responses. These peptides (typically 15-mers) are arranged in pools for initial screening, with positive pools deconvoluted to identify individual stimulatory peptides . The IFN-γ enzyme-linked immunospot (ELISPOT) assay is a particularly sensitive method for this screening, measuring the frequency of antigen-specific T cells that secrete IFN-γ in response to peptide stimulation . To be considered positive, peptides must yield a statistically significant response above background (typically >20 spot-forming cells per million and a stimulation index >1.4) .

For further characterization, intracellular cytokine staining (ICCS) followed by flow cytometry allows quantification of the percentage of CD4+ or CD8+ T cells responding to specific epitopes . This technique provides information about both the frequency of responding cells and their phenotype. Epitope-specific T cell lines can be established by repeated stimulation with identified epitopes, allowing detailed functional studies of epitope-specific responses.

The physiological relevance of identified epitopes can be assessed through adoptive transfer experiments, where epitope-specific T cells are transferred into naive recipients before viral challenge to determine their protective capacity. In the case of the A28 protein, research has shown that peptides derived from this protein can elicit T cell responses, although the A28L peptide showed positive results in ELISPOT assays but only marginal positivity in ICCS assays .

How does the immune system recognize the A28 protein, and what are the implications for vaccine development?

The immune system recognizes the A28 protein through both humoral and cell-mediated mechanisms, each contributing differently to antiviral immunity. On the humoral side, antibodies against A28 can bind to intact virions and neutralize infectivity, as demonstrated with antisera raised against recombinant A28 protein . A specific neutralizing epitope has been identified between residues 73 and 92 of the A28 protein, highlighting a region particularly important for antibody-mediated protection . These antibodies likely function by blocking the interaction of A28 with cellular receptors or by interfering with conformational changes necessary for membrane fusion.

For cell-mediated immunity, A28-derived peptides can be processed and presented by MHC class II molecules to CD4+ T cells. Studies have identified A28L-derived peptides that elicit T cell responses in ELISPOT assays, although these responses may be relatively modest compared to other viral antigens . Interestingly, the A28 protein belongs to the category of late antigens that predominate as CD4+ T cell targets, which differs from the early antigens preferentially recognized by CD8+ T cells .

These immunological properties have significant implications for vaccine development. The ability of anti-A28 antibodies to neutralize virus and provide partial protection in passive immunization experiments suggests that vaccines designed to elicit strong antibody responses against this protein could contribute to protective immunity . The identification of specific neutralizing epitopes allows for the design of epitope-focused vaccines that concentrate the immune response on protective determinants. Additionally, understanding the T cell epitopes in A28 enables the development of vaccines that stimulate balanced humoral and cell-mediated responses for optimal protection.

What are the most effective methods for producing neutralizing antibodies against the A28 protein?

Producing effective neutralizing antibodies against the A28 protein requires strategic approaches informed by the protein's structure and immunological properties. The most successful method demonstrated in research involves expressing soluble recombinant forms of A28 by replacing its transmembrane domain with a signal peptide and adding a polyhistidine tag for purification . This approach preserves the protein's major antigenic domains while eliminating the hydrophobic regions that can interfere with proper folding and immunogenicity.

For optimal antibody production, the purified recombinant A28 protein should be formulated with appropriate adjuvants before immunization. Complete Freund's adjuvant for initial immunization followed by incomplete Freund's adjuvant for boosters has proven effective in rabbit models . The immunization schedule typically involves an initial dose followed by multiple boosters at 2-4 week intervals to drive affinity maturation of the antibody response.

To focus the immune response on neutralizing epitopes, researchers can design immunogens based on known neutralizing regions, such as the identified epitope between residues 73 and 92 of A28 . Synthetic peptides corresponding to this region, when conjugated to carrier proteins like keyhole limpet hemocyanin (KLH), can elicit epitope-specific antibodies that may possess neutralizing activity.

Evaluation of neutralizing antibodies requires specialized assays beyond standard binding tests. Plaque reduction neutralization tests (PRNTs) measure the ability of antibodies to prevent viral infection of cell monolayers, while fusion inhibition assays assess interference with A28's role in membrane fusion. Additionally, biosensor-based methods can provide quantitative measurements of antibody-antigen binding kinetics and affinities, helping identify the most promising neutralizing antibodies for further development.

For therapeutic applications, monoclonal antibodies against critical A28 epitopes may offer advantages over polyclonal sera in terms of specificity and reproducibility. These can be generated using hybridoma technology following immunization with recombinant A28 or through phage display libraries, with selection for clones exhibiting neutralizing activity.

What is the comparative immunogenicity of A28 protein in different vaccine platforms?

The comparative immunogenicity of A28 protein across different vaccine platforms represents an important research question with implications for vaccine design. Each platform offers distinct advantages and limitations for presenting A28 to the immune system, affecting the quality and magnitude of the resulting immune response.

Recombinant protein subunit vaccines using purified A28 with appropriate adjuvants can induce strong antibody responses, particularly when the protein is properly folded with intact neutralizing epitopes . The advantage of this approach is precise control over antigen dose and formulation, though it may be less effective at generating CD8+ T cell responses. Experiments show that soluble recombinant A28 used for immunization can generate antibodies that neutralize vaccinia virus infectivity, demonstrating the potential of this approach .

DNA vaccines encoding A28 represent another platform where the gene is delivered via plasmid vectors, allowing for intracellular expression and processing of the antigen. This approach can stimulate both antibody and T cell responses, including CD8+ T cells through cross-presentation. The A28 sequence can be optimized for codon usage and expression efficiency, and co-delivery with genetic adjuvants like cytokine genes can enhance immunogenicity.

Viral vector vaccines, such as modified vaccinia Ankara (MVA) or adenovirus expressing A28, combine the advantages of subunit specificity with the immunostimulatory properties of viral infection. These vectors efficiently infect antigen-presenting cells and typically induce balanced humoral and cellular immunity. Given that A28 is naturally expressed by vaccinia virus, MVA would already contain the A28 antigen, but overexpression constructs could potentially enhance the A28-specific response.

mRNA-based vaccines represent a newer platform where A28-encoding mRNA is delivered in lipid nanoparticles, leading to transient antigen expression. This approach has shown promise for generating both antibody and T cell responses in other systems and offers advantages in terms of manufacturing and safety.

For comprehensive evaluation, comparative studies should assess not only antibody titers and T cell frequencies but also functional measures such as neutralizing capacity, antibody affinity, T cell cytokine profiles, and memory formation. Protection studies in animal models would ultimately determine which platform or combination of platforms optimally presents A28 to achieve protective immunity.

How can researchers reconcile discrepancies between different assays when evaluating A28-specific immune responses?

Reconciling discrepancies between different assays when evaluating A28-specific immune responses requires a systematic approach to understand the technical limitations and biological implications of each method. A notable example is the observation that an A28L peptide showed positive results in ELISPOT assays but only marginal positivity in intracellular cytokine staining (ICCS) assays . Such discrepancies are not uncommon in immunological research and require careful analysis.

First, researchers should consider the inherent sensitivity differences between assays. ELISPOT is generally more sensitive than ICCS for detecting low-frequency T cell responses because it measures cytokine secretion accumulated over time, while ICCS provides a snapshot of intracellular cytokine content at a specific timepoint . For A28-specific responses that may be relatively modest, ELISPOT might detect signals that fall below the detection threshold of ICCS.

Technical variables must also be examined, including peptide concentration, incubation time, cell numbers, and the statistical criteria for positivity. For instance, the criteria used in T cell epitope mapping studies (>20 spot-forming cells per million and a stimulation index >1.4) establish thresholds that may be passed by ELISPOT but not by less sensitive assays . Standardizing these parameters across assays whenever possible helps minimize artificial discrepancies.

Biological factors may also explain genuine differences between assay results. The kinetics of cytokine production and secretion vary among T cell subsets and can differ for IFN-γ versus other cytokines. Additionally, peptide binding affinity to MHC molecules, TCR avidity, and the presence of regulatory T cells can all influence the magnitude of responses detected by different assays.

To reconcile these discrepancies, researchers should employ a multi-parametric approach, combining results from complementary assays to build a more complete picture. This might include functional assays (proliferation, cytotoxicity), multi-cytokine analyses, and assessment of memory phenotypes. When possible, epitope-specific T cell clones or lines should be established to permit detailed characterization without the confounding influence of other specificities.

Statistical approaches, such as receiver operating characteristic (ROC) curve analysis, can help establish optimal cutoff values that maximize concordance between assays. Finally, correlation with protection in animal models provides the ultimate biological validation, regardless of discrepancies between in vitro assays.

How can researchers design experiments to distinguish between the roles of A28 in virus assembly versus entry?

Designing experiments to distinguish between the roles of A28 in virus assembly versus entry requires sophisticated approaches that can temporally separate these distinct phases of the viral life cycle. The dual potential involvement of A28 in both processes presents a challenging experimental problem requiring careful methodological design.

Conditional expression systems represent one of the most powerful approaches for this differentiation. Using the inducible A28L system (vA28-HAi) , researchers can add or remove the inducer (IPTG) at different times to control A28 expression. By withdrawing the inducer after assembly but before entry (using synchronized infections), researchers can determine whether preformed virions lacking newly synthesized A28 remain infectious. Conversely, inducing A28 expression only during entry phases would reveal whether A28 must be present during assembly to function properly in entry.

Complementation assays provide another approach. Cells expressing A28 can be infected with A28-deficient virus to determine if providing A28 in trans rescues the assembly defect but not the entry defect (or vice versa). This separation would indicate stage-specific functions. Similarly, heterologous expression systems where A28 is provided in isolation from other viral proteins can help assess its sufficiency for specific functions.

Electron microscopy combined with immunogold labeling for A28 allows visualization of A28's location during different stages of the viral life cycle. This approach can reveal whether A28 localizes to sites of virion assembly in the cytoplasm or primarily associates with mature virions at the cell surface during entry events. Time-course studies with fine temporal resolution would be particularly informative.

Temperature-sensitive mutations in A28 could potentially separate assembly from entry functions if the protein has different structural requirements for each role. By identifying mutations that affect one process but not the other, researchers can map functional domains specific to assembly versus entry.

Biochemical approaches including crosslinking studies can identify A28's interaction partners during different phases. If A28 interacts with one set of proteins during assembly and a different set during entry, this would support distinct functional roles. Proximity labeling techniques such as BioID could map these temporal differences in the A28 interactome.

Single-particle tracking of fluorescently labeled A28 in live cells would provide dynamic information about A28's behavior during assembly and entry phases, potentially revealing distinct movement patterns, clustering behaviors, or membrane associations that correlate with different functions.

What are the best approaches for studying the evolutionary conservation and diversity of A28 proteins across different poxviruses?

Studying the evolutionary conservation and diversity of A28 proteins across poxviruses requires an integrated approach combining computational analyses with experimental validation. This comprehensive strategy reveals both conserved functional domains and lineage-specific adaptations that may reflect host-specific pressures or virus-specific requirements.

Comparative genomic analysis forms the foundation of this approach. Researchers should compile A28 homologs from diverse poxvirus species spanning different genera using database searches and genome mining. Multiple sequence alignment tools such as MUSCLE, MAFFT, or T-Coffee can then align these sequences to identify conserved residues, insertion/deletion events, and variable regions. Conservation analysis tools can quantify the degree of evolutionary constraint at each position, revealing functionally critical residues versus those under relaxed selection. Particularly important are the four conserved cysteines known to form disulfide bonds in vaccinia virus A28 , which may serve as markers for functional conservation.

Selection analysis using methods like PAML or HyPhy can detect signatures of positive (diversifying) or negative (purifying) selection across the A28 sequence. This approach identifies specific codons under different selective regimes, providing insights into regions involved in host adaptation versus those constrained by essential functions. For instance, the transmembrane domain and disulfide bond-forming cysteines likely experience strong purifying selection, while surface-exposed regions might show elevated rates of positive selection in response to host immune pressures.

Structural biology approaches complement sequence analysis by mapping conservation patterns onto three-dimensional protein structures. While the complete structure of A28 remains to be determined, homology modeling using related protein structures can generate prediction models. These models allow visualization of whether conserved residues cluster in specific functional domains and whether variable regions correspond to surface-exposed epitopes.

Experimental validation of computational predictions is essential. This includes expressing A28 homologs from different poxviruses in vaccinia virus A28-null backgrounds to test functional complementation. Cross-species neutralization assays with anti-A28 antibodies can determine whether neutralizing epitopes are conserved across poxvirus lineages. Site-directed mutagenesis targeting conserved residues can verify their functional importance across different virus species.

How might targeting the A28 protein contribute to novel antiviral strategies against poxviruses?

Targeting the A28 protein represents a promising strategy for novel antivirals against poxviruses due to its essential role in viral entry and its high conservation across poxvirus species. Several approaches leverage A28's unique properties to interfere with viral replication through distinct mechanisms.

Small molecule inhibitors designed to bind specifically to A28 could disrupt its interaction with other EFC components or host receptors. Structure-based drug design, though currently limited by the lack of a complete A28 structure, could target conserved functional domains identified through sequence analysis. High-throughput screening of chemical libraries using cell-based fusion assays or protein-protein interaction assays would identify lead compounds that specifically interfere with A28 function. The unique disulfide bonds in A28's cytoplasmic domain offer particularly attractive targets, as these structures are rare in cytoplasmic proteins but essential for A28 function .

Peptide-based inhibitors derived from A28-interacting regions of other EFC components could compete with natural interactions, preventing proper complex formation. Similarly, peptides mimicking the A28 neutralizing epitope (residues 73-92) might interfere with A28's functional interactions . These peptides could be optimized for stability, cell penetration, and binding affinity through techniques like stapling or non-natural amino acid incorporation.

Monoclonal antibodies against A28 have demonstrated neutralizing activity and protective effects in passive immunization experiments . Humanized or fully human monoclonal antibodies targeting the identified neutralizing epitope could serve as therapeutics for poxvirus infections. Bispecific antibodies linking A28 recognition with recruitment of immune effectors could enhance viral clearance beyond simple neutralization.

RNA interference or antisense oligonucleotides targeting A28 mRNA could prevent protein synthesis during infection. While delivery remains challenging, advances in lipid nanoparticles and conjugated delivery systems are improving the feasibility of nucleic acid-based therapeutics. Similarly, CRISPR-Cas systems adapted for RNA targeting could specifically cleave A28 transcripts.

Inhibitors of the viral redox pathway that forms disulfide bonds in A28 represent an indirect approach. Since A28 function depends on disulfide bond formation mediated by the E10, A2.5, and G4 proteins , compounds that inhibit this pathway would prevent proper A28 folding and function. This strategy might have broader effects by simultaneously affecting multiple viral proteins dependent on this pathway.

What are the key considerations when designing vaccines that target the A28 protein?

Designing vaccines that target the A28 protein requires careful consideration of several key factors to optimize immunogenicity, protective efficacy, and safety. The unique characteristics of A28 present both opportunities and challenges for vaccine development.

Protein conformation is particularly important for A28 due to its complex structure featuring disulfide bonds . Recombinant A28 vaccines must ensure proper protein folding to present native epitopes to the immune system. This may require expression systems that support disulfide bond formation, such as eukaryotic cells rather than bacterial systems. For soluble recombinant forms, careful design of constructs that replace the transmembrane domain while preserving critical epitopes is essential .

Adjuvant selection significantly impacts the magnitude and quality of immune responses to A28. Since protection likely requires both neutralizing antibodies and T cell responses, adjuvants that promote balanced immunity should be prioritized. Combinations of TLR agonists with saponins or emulsions might optimize responses to A28-based vaccines. Testing multiple adjuvant formulations in comparative studies would identify optimal combinations.

Delivery platforms affect how A28 is presented to the immune system. Options include recombinant protein subunit vaccines, viral vectors expressing A28, DNA vaccines encoding A28, or mRNA vaccines. Each platform has distinct advantages: protein vaccines excel at inducing antibodies, viral vectors generate strong T cell responses, while nucleic acid vaccines offer manufacturing advantages. Prime-boost regimens combining different platforms (e.g., DNA prime with protein boost) might maximize both arms of immunity against A28.

Safety considerations include avoiding epitopes that might induce autoimmunity through molecular mimicry with host proteins. Additionally, for viral vector or whole inactivated virus vaccines containing A28, ensuring complete inactivation or attenuation is critical to prevent adverse reactions.

How can structural analysis of the A28 protein inform better antiviral and vaccine designs?

Structural analysis of the A28 protein provides critical insights that can significantly enhance both antiviral and vaccine design efforts. Though the complete three-dimensional structure of A28 remains to be determined, even partial structural information combined with computational modeling can accelerate therapeutic development.

For antiviral development, structural data enables structure-based drug design targeting specific functional domains of A28. High-resolution structures would reveal potential binding pockets for small molecule inhibitors, particularly at interfaces where A28 interacts with other components of the entry/fusion complex. The unusual disulfide bonds in A28's cytoplasmic domain represent particularly promising targets, as their formation is essential for function and depends on a specialized viral pathway . Structural analysis of these disulfide bonds and surrounding regions could guide the design of compounds that either prevent bond formation or disrupt the conformation that results from these bonds.

Epitope mapping through structural studies identifies exactly which residues comprise antibody binding sites, especially the neutralizing epitope between positions 73-92 . Techniques such as X-ray crystallography or cryo-electron microscopy of antibody-A28 complexes would reveal the three-dimensional configuration of these epitopes. This knowledge allows for epitope-focused vaccine design, where immunogens are engineered to present these critical epitopes in their native conformation while eliminating non-neutralizing or potentially harmful epitopes.

Conformational dynamics revealed through techniques like hydrogen-deuterium exchange mass spectrometry or molecular dynamics simulations can identify flexible regions of A28 that undergo conformational changes during membrane fusion. These dynamic regions often represent vulnerability points where antivirals could lock the protein in inactive conformations, preventing the structural transitions necessary for fusion activity.

Structure-guided immunogen design can overcome limitations of natural A28 as a vaccine antigen. By understanding the protein's domain architecture, researchers can create optimized constructs that maintain key epitopes while improving expression, stability, and immunogenicity. For instance, stabilizing the protein in its prefusion conformation through strategic mutations or chemical crosslinking could better present neutralizing epitopes that might be transiently exposed during the fusion process.

Comparative structural analysis across A28 homologs from different poxviruses illuminates conservation patterns in three dimensions rather than just sequence. This approach identifies structurally conserved pockets that might be less obvious from sequence alignment alone, potentially revealing new targets for broad-spectrum antivirals effective against multiple poxvirus species.

What methods can be used to evaluate the efficacy of A28-targeted interventions in animal models?

Evaluating the efficacy of A28-targeted interventions in animal models requires comprehensive methodological approaches that assess protection across multiple parameters while providing mechanistic insights. Several complementary methods can together provide robust evidence of efficacy and potential translational value.

Challenge studies represent the gold standard for efficacy assessment. Vaccinated or treated animals are exposed to infectious virus through relevant routes (intranasal, intradermal, or intravenous) depending on the model and disease being studied. Survival rates, weight loss curves, and clinical scoring provide primary efficacy endpoints. For passive immunization studies with anti-A28 antibodies, dose-response relationships should be established to determine minimum protective titers . Challenge viruses should include both homologous strains and, when evaluating cross-protection, heterologous poxviruses with variant A28 proteins.

Viral load quantification in tissues provides critical information about intervention effects on viral replication. Quantitative PCR for viral DNA, plaque assays for infectious virus, and immunohistochemistry for viral antigen distribution can track virus spread and clearance dynamics. Sampling multiple tissues (skin, lungs, spleen, lymph nodes) captures systemic effects and identifies tissues where the intervention is most effective. The timing of viral clearance relative to intervention provides insights into mechanism of action.

Immune correlates of protection should be thoroughly characterized to understand how A28-targeted interventions confer protection. For vaccines, antibody titers (including neutralizing antibody levels), antibody isotypes, antibody avidity, and epitope specificity should be measured. T cell responses can be assessed through ELISpot assays, intracellular cytokine staining, and proliferation assays . Adoptive transfer experiments, where serum or T cells from vaccinated animals are transferred to naive recipients before challenge, can distinguish which immune components mediate protection.

Histopathological assessment provides information about tissue damage and inflammatory responses. This approach is particularly important for evaluating whether interventions prevent pathology even if they don't completely eliminate viral replication. Special staining for immune cell infiltrates can characterize the inflammatory response and potential immunopathology.

Transgenic and knockout mouse models offer powerful tools for mechanistic studies. Mice lacking specific components of the immune system (such as B cells, CD4+ T cells, or CD8+ T cells) can reveal which arms of immunity are essential for A28-targeted vaccine efficacy. Similarly, humanized mice expressing human MHC molecules can better predict epitope recognition and vaccine efficacy in humans.

Non-human primate models, while more expensive and ethically complex, provide the closest approximation to human disease for orthopoxvirus infections. These models are particularly valuable for late-stage evaluation of promising A28-targeted interventions before human clinical trials, especially for assessing safety and dosing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.