Recombinant Vacuolar ATPase assembly integral membrane protein VMA21 (pdcd-2)

Shipped with Ice Packs
In Stock

Description

Role in V-ATPase Assembly and Function

VMA21 facilitates the proper assembly of the V₀ domain, which includes subunits such as ATP6V0C and ATP6V0D1 . Mutations in VMA21 disrupt this process, leading to:

  • Reduced expression of V₀ subunits (e.g., ATP6V0C/D1) .

  • Impaired proton-pumping activity, causing lysosomal deacidification .

  • Defective autophagy, as seen in X-linked myopathy with excessive autophagy (XMEA) .

Structural Insights:
Cryo-EM studies reveal that VMA21 binds the c-ring of the V₀ domain, stabilizing its assembly. In yeast, Vma21p (the ortholog) interacts with Vma12p and Vma22p to form a transient complex during V₀ assembly . Human VMA21 retains this function but lacks the ER-retrieval motif present in yeast Vma21p .

Clinical Relevance and Disease Associations

Diseases Linked to VMA21 Deficiency:

DiseaseMechanismKey Features
XMEA (Muscle)Loss of VMA21-120 isoform; autophagy defectsProgressive muscle weakness, autophagic vacuoles, and myopathy
Congenital Disorders of Glycosylation (CDG)Impaired V-ATPase assembly; ER stressHepatopathy, elevated LDL cholesterol, and abnormal protein glycosylation

Cancer Implications:

  • Colorectal cancer (CRC): VMA21 upregulation correlates with favorable disease-specific survival (DSS). Overexpression suppresses CRC growth in vitro and in vivo .

  • Dual role: While VMA21 deficiency impairs lysosomal degradation, its upregulation may inhibit tumor progression by modulating autophagy .

Disease Modeling

  • XMEA Models: siRNA knockdown or CRISPR-edited VMA21-deficient cells recapitulate autophagic vacuoles and ER stress .

  • CDG Models: Patient-derived fibroblasts exhibit truncated N/O-glycans and cholesterol sequestration in lysosomes .

Recombinant VMA21 in Therapeutic Development

  • Target Validation: Studies leverage recombinant VMA21 to test V-ATPase inhibitors/activators for diseases like osteoporosis, cancer, and neurodegeneration .

  • Diagnostic Biomarkers: VMA21 expression levels may predict CRC prognosis or monitor glycosylation defects in CDG .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pdcd-2; R07E5.10; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
pdcd-2
Target Protein Sequence
MTTSSSSEPSTMATLFPNFRDQEVQSAVKNLLTYSLVILIVPLASMFLLKQFFFEGLLGV SANDALTYSAIIAVVLVHVVLGIWLFAATKQEDRKKRENKQD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum. This complex plays a crucial role in maintaining cellular pH and transporting ions across membranes.
Database Links

UniGene: Cel.10213

Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of VMA21 protein?

VMA21 is a small transmembrane protein consisting of 101 amino acids in humans. Topologically, it has cytoplasmic N and C termini with two transmembrane segments connected via a lumenal domain. VMA21 functions as an essential chaperone for the vacuolar H⁺-ATPase (V-ATPase) complex assembly in the endoplasmic reticulum (ER). The protein is crucial for the proper assembly of the V-ATPase V₀ complex and its subsequent translocation to lysosomes .

In experimental settings, researchers can study VMA21's structure using techniques such as immunoprecipitation followed by mass spectrometry analysis to identify interaction partners and post-translational modifications. Circular dichroism spectroscopy and NMR can provide insights into the protein's secondary structure elements and membrane topology.

How does VMA21 contribute to V-ATPase assembly and trafficking?

VMA21 serves as both an assembly factor and chaperone for the V₀ complex of V-ATPase. The protein accompanies the V₀ complex during its trafficking from the ER to the Golgi apparatus. Upon arrival at the Golgi, wild-type VMA21 typically dissociates from the V₀ complex and is shuttled back to the ER via a C-terminal retrieval mechanism .

Researchers can track this process using pulse-chase experiments with fluorescently-tagged VMA21 constructs and V₀ complex components. Brefeldin A treatment can be used to disrupt ER-Golgi trafficking to confirm the importance of these pathways for VMA21 function. Co-immunoprecipitation experiments can identify the specific components of the V₀ complex that directly interact with VMA21 during assembly.

What is the cellular localization pattern of VMA21?

Wild-type VMA21 predominantly localizes to the ER and Golgi apparatus. Although human VMA21 lacks a typical COPI recognition signal (KKXX or KXKXX) at the C-terminus for retrograde transport from Golgi to ER, it contains alternative sequences that facilitate this process. In contrast, mutant VMA21 with C-terminal deletions (e.g., p.93X mutation) shows abnormal enrichment in lysosomes, as demonstrated by increased colocalization with lysosomal markers like LAMP1 .

For experimental validation, confocal microscopy using differentially tagged organelle markers and immunofluorescence with anti-VMA21 antibodies provides the most reliable localization data. Subcellular fractionation followed by western blotting can provide quantitative assessment of VMA21's distribution across cellular compartments.

What are the most effective experimental systems to study VMA21 function?

Several complementary experimental systems have proven valuable for investigating VMA21 function:

  • Cell line models: Stable HEK293T cells with doxycycline-inducible expression of wild-type or mutant VMA21 have been successfully used to study the protein's effects on autophagy and V-ATPase function .

  • Zebrafish models: The vma21 mutant zebrafish model has provided insights into the in vivo consequences of VMA21 deficiency, particularly on muscle and liver pathology. These models can be generated using CRISPR/Cas9 approaches and analyzed using histological techniques and fluorescent reporters for autophagy .

  • Yeast systems: Given the evolutionary conservation of V-ATPase assembly, S. cerevisiae with mutations in the Vma21 homolog can serve as a simplified model for functional studies .

To assess autophagic flux in these systems, researchers should employ multiple complementary assays including LC3-II western blotting with and without bafilomycin A1 treatment, GFP-LC3-RFP-LC3ΔG constructs for flux measurements, and electron microscopy to quantify autophagosomes and autolysosomes .

How can researchers accurately assess the impact of VMA21 mutations on lysosomal acidification?

Lysosomal acidification defects represent a critical consequence of VMA21 dysfunction. Researchers can employ several methodologies to quantify these effects:

  • LysoSensor or LysoTracker dyes: These pH-sensitive fluorescent probes can be used to visualize and quantify lysosomal pH changes in live cells using confocal microscopy.

  • Ratiometric pH measurements: More precise quantification of lysosomal pH can be achieved using dual-wavelength ratiometric probes or fluorescently labeled dextrans calibrated against known pH standards.

  • V-ATPase activity assays: Direct measurement of V-ATPase activity in isolated organelle fractions using ATP hydrolysis assays coupled with specific V-ATPase inhibitors (e.g., bafilomycin A1) to determine the specific contribution of V-ATPase to total ATPase activity.

  • Protein degradation assays: Since lysosomal acidification is essential for proper protein degradation, pulse-chase experiments with labeled proteins can assess the functional consequences of impaired acidification due to VMA21 mutations .

Control experiments should include bafilomycin A1 treatment as a positive control for complete V-ATPase inhibition and comparison between wild-type and known pathogenic VMA21 variants .

What is the mechanism by which VMA21 mutations lead to X-linked myopathy with excessive autophagy (XMEA)?

XMEA is a rare recessive disease with childhood onset caused by mutations in VMA21. The pathophysiological cascade appears to involve:

  • V-ATPase assembly defects: Mutations in VMA21 impair proper V-ATPase assembly, reducing the pool of functional V-ATPase complexes available for lysosomal acidification.

  • Impaired lysosomal acidification: The resultant decrease in lysosomal pH prevents optimal activity of pH-dependent lysosomal hydrolases.

  • Disrupted autophagic flux: Evidence from both patient samples and model systems demonstrates that VMA21 mutations lead to accumulation of LC3-I and LC3-II with a corresponding decrease in the LC3-II/LC3-I ratio, consistent with disruption of autophagic flux .

  • Formation of characteristic vacuoles: In muscle fibers, this disruption results in the formation of double-membrane vacuoles containing extracellular matrix and membrane components, which is the histopathological hallmark of XMEA .

For experimental validation, researchers can use transgenic GFP-LC3-RFP-LC3ΔG constructs in cell or zebrafish models, which show a higher GFP:RFP ratio in VMA21 mutants, indicating lower autophagic flux .

How do VMA21 mutations contribute to liver pathology?

VMA21 mutations have been associated with autophagic liver disease characterized by:

  • Steatosis and lipid accumulation: Histological examination of VMA21-deficient livers reveals considerable lipid deposition in hepatocytes, suggesting hepatic steatosis .

  • Cholestasis: VMA21 mutant zebrafish show impaired bile flux as evidenced by reduced fluorescence in the gallbladder after PED6 dye administration, implying an underlying cholestatic liver phenotype .

  • Liver size reduction: Morphometric analysis demonstrates that VMA21 deficiency leads to significant reduction in liver size, suggestive of liver dysfunction .

  • Biochemical abnormalities: Patients with VMA21 mutations display chronic elevation of aminotransferases, elevated LDL cholesterol, and mild cholestasis .

The molecular mechanism appears to involve impaired lysosomal degradation of phagocytosed materials causing lipid droplet accumulation in autolysosomes and sequestration of unesterified cholesterol in lysosomes, which activates SREBP-mediated cholesterol synthesis pathways .

Researchers can utilize Oil Red O staining or BODIPY dyes to quantify lipid accumulation, and employ transgenic zebrafish lines marking the liver (e.g., Tg(Fabp:mCherry)) to assess liver size and morphology in VMA21 deficiency models .

What role does VMA21 play in follicular lymphoma pathogenesis?

Recent studies have identified recurrent mutations in VMA21 in approximately 12% of follicular lymphoma (FL) cases. The pathogenic mechanism involves:

  • Hotspot mutations: A significant hotspot nonsense mutation (c.C277T; p.R93X) comprises about 40% of all detected mutations in FL, resulting in deletion of the C-terminal nine amino acids .

  • Protein mislocalization: Wild-type VMA21 predominantly localizes to the ER/Golgi, while mutant VMA21 shows abnormal enrichment in lysosomes due to the loss of the C-terminal retrieval signal .

  • V-ATPase dysfunction: These mutations cause V-ATPase misassembly and dysfunction, preventing complete lysosomal acidification .

  • Compensatory autophagy activation: The lysosomal defects trigger a compensatory activation of autophagy, creating a survival dependency that might be exploited therapeutically .

For experimental investigation, researchers can use electron microscopy to enumerate autophagosomes, autolysosomes, and late endosomes/lysosomes in cells expressing wild-type versus mutant VMA21. Studies have shown that the number of autolysosomes is substantially and significantly elevated in VMA21 p.93X mutant cell lines, confirming pathological elevation of autophagic flux .

What are potential therapeutic targets based on VMA21 dysfunction mechanisms?

Several therapeutic approaches targeting the pathways affected by VMA21 dysfunction show promise:

  • Autophagy inhibition: VMA21-mutant cells show dependency on autophagy for survival. Inhibitors of ULK1 (e.g., MRT68921) and PIK3C3/VPS34 (e.g., SAR405), which are proximal autophagy-regulating kinases, have shown efficacy in inhibiting VMA21-MUT induced autophagic flux .

  • Cyclin-dependent kinase inhibitors: High-throughput screening has identified multiple clinical-grade cyclin-dependent kinase inhibitors as promising drugs for targeting VMA21-mutant follicular lymphoma cells through their autophagy-inhibitory properties .

  • Lysosomal pH modulators: Compounds that can restore lysosomal acidification might correct the fundamental defect in VMA21 dysfunction.

  • ER stress modulators: Since VMA21 deficiency triggers ER stress, compounds that alleviate this stress response could provide therapeutic benefit .

Experimental designs to evaluate these approaches should include comparative analysis of cell viability, autophagic flux, and lysosomal pH in wild-type versus VMA21-mutant cells, with dose-response curves to determine optimal therapeutic windows.

How can researchers effectively model VMA21 deficiency in different systems to test interventions?

Researchers have successfully developed several model systems for studying VMA21 deficiency:

  • Cell-based models:

    • Stable HEK293T cells with doxycycline-inducible expression of wild-type or mutant VMA21

    • CRISPR/Cas9-mediated knockout or knockin of VMA21 mutations in relevant cell types

    • Patient-derived primary cells (e.g., myoblasts, lymphocytes)

  • Zebrafish models:

    • CRISPR/Cas9-generated vma21 mutant zebrafish that recapitulate muscle and liver pathology

    • Transgenic reporter lines (e.g., GFP-LC3) to visualize autophagy in vivo

  • Yeast models:

    • S. cerevisiae with mutations in the Vma21 homolog for high-throughput drug screening

Each model system offers distinct advantages: cell models allow for detailed molecular studies and high-throughput screening; zebrafish models provide insights into tissue-specific pathology and in vivo drug efficacy; yeast models enable rapid genetic manipulations and functional conservation studies .

To validate these models, researchers should confirm that they recapitulate key features of VMA21 deficiency including impaired V-ATPase assembly, lysosomal acidification defects, and disrupted autophagic flux using the methodologies described in previous sections.

What are the critical quality control parameters for recombinant VMA21 protein production?

Production of high-quality recombinant VMA21 protein for research purposes requires careful attention to several parameters:

  • Expression system selection: As a small transmembrane protein, VMA21 may require eukaryotic expression systems (insect cells or mammalian cells) rather than bacterial systems to ensure proper membrane insertion and folding.

  • Purification strategy: Detergent selection is critical - mild non-ionic detergents like DDM or LMNG can extract VMA21 while preserving its native conformation. Affinity tags should be positioned to avoid interfering with transmembrane domains or C-terminal trafficking signals.

  • Quality control assays:

    • SDS-PAGE and western blotting to confirm protein size and purity

    • Mass spectrometry to verify sequence integrity and post-translational modifications

    • Circular dichroism to confirm proper secondary structure

    • Size-exclusion chromatography to assess monodispersity and aggregation state

  • Functional validation: Purified VMA21 should be tested for its ability to associate with V-ATPase V₀ components using reconstitution assays or surface plasmon resonance.

For structure-function studies, researchers should consider producing both wild-type VMA21 and disease-associated variants to compare their biochemical and biophysical properties.

How can researchers quantitatively assess VMA21-dependent autophagy activation?

Given the importance of autophagy in VMA21-related pathology, several quantitative approaches can be employed:

  • Western blot analysis: Quantification of LC3-I to LC3-II conversion with and without lysosomal inhibitors (e.g., bafilomycin A1). VMA21 mutant cells typically show elevated LC3-II levels and further increases upon bafilomycin A1 treatment, indicating elevated autophagic flux .

  • Fluorescence microscopy-based assays:

    • GFP-LC3-RFP-LC3ΔG reporter system, which allows for flux measurements based on the GFP:RFP ratio

    • Tandem mRFP-GFP-LC3 constructs to distinguish autophagosomes from autolysosomes

  • Electron microscopy quantification: Counting of autophagosomes, autolysosomes, and late endosomes/lysosomes in transmission electron microscopy images. VMA21 mutant cells show significantly elevated numbers of autolysosomes (approximately 4-fold increase compared to wild-type) .

  • Selective autophagy assays: For example, in yeast systems, the maturation of prApe1 can be monitored, particularly in a vac8Δ background, which allows assessment of autophagic delivery under nitrogen-starvation conditions .

A comprehensive assessment should incorporate multiple complementary methods to provide robust quantification of autophagic alterations in response to VMA21 manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.