Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vanderwaltozyma polyspora Altered Inheritance of Mitochondria Protein 31, Mitochondrial (AIM31)

Recombinant Vanderwaltozyma polyspora Altered Inheritance of Mitochondria Protein 31, mitochondrial (AIM31), is a recombinant protein derived from the yeast Vanderwaltozyma polyspora. This protein is involved in the regulation and assembly of mitochondrial respiratory supercomplexes, particularly in association with the cytochrome bc1-cytochrome c oxidase (COX) supercomplex. AIM31 has been identified as a member of the hypoxia-induced gene 1 (Hig1) protein family and plays a crucial role in mitochondrial function.

Structure and Expression

The recombinant AIM31 protein is typically expressed in Escherichia coli and is fused with an N-terminal His tag for purification purposes. The protein consists of 162 amino acids (1-162aa) and is encoded by the gene A7TFU8 . The His tag facilitates the purification process using affinity chromatography, which is essential for studying the protein's structure and function.

Function and Role in Mitochondria

AIM31, also known as Rcf1 (respiratory supercomplex factor 1), is closely associated with the cytochrome bc1-COX supercomplex. It interacts primarily with the COX complex, particularly the Cox3 subunit, and acts as a bridge to support the assembly of this supercomplex . The presence of AIM31 is crucial for the optimal activity and assembly of the COX enzyme, which is a key component of the mitochondrial electron transport chain (ETC).

Overlapping Function with AIM38

AIM31 shares an overlapping function with another mitochondrial protein, AIM38 (also known as Rcf2), which is also involved in the assembly and regulation of the cytochrome bc1-COX supercomplex . Both proteins can independently associate with the supercomplex, but their joint presence is necessary for optimal COX enzyme activity and correct supercomplex assembly.

Research Findings

Recent studies have highlighted the importance of AIM31 in maintaining mitochondrial function. The protein's association with the COX complex and its role in supercomplex assembly suggest that it plays a critical part in regulating mitochondrial respiration and energy production .

Suppliers and Availability

AIM31 is available from several suppliers, including Creative BioMart and CUSABIO TECHNOLOGY LLC .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please specify this during order placement for preferential development.
Synonyms
RCF1; AIM31; Kpol_1023p75; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
RCF1
Target Protein Sequence
MSRIPSSFDYKDNVKDVSEMDFMEKLVFRAKQQPLVPIGCLLTTGAIVLAAQSVRSGNKN KAQVFFRWRVGLQAATLVALLAGSYIYSSNKAERKTEEQLLKEKAKMREQLWIQELERRE QETEARRKKAEMFRLKAKENEEASKNLEQELKALESKVNASK
Uniprot No.

Target Background

Function

Function: Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is AIM31 in Vanderwaltozyma polyspora and what is its function?

AIM31 (Altered inheritance of mitochondria protein 31) is a mitochondrial protein found in the yeast species Vanderwaltozyma polyspora. The protein is localized to mitochondria and plays a crucial role in mitochondrial function and genome stability. Based on homology with similar proteins in other yeast species, it may interact with respiratory chain complexes III or IV, and null mutants display reduced frequency of mitochondrial genome loss . AIM31 is also known as RCF1 (Respiratory supercomplex factor 1) in some species and contributes to the proper formation and function of mitochondrial respiratory supercomplexes .

What are the optimal conditions for expressing recombinant V. polyspora AIM31?

Recombinant V. polyspora AIM31 can be effectively expressed in bacterial expression systems such as E. coli. Based on protocols for similar mitochondrial proteins, expression optimization involves:

  • Vector selection: pET-based or similar expression vectors with appropriate affinity tags

  • Expression conditions: Induction at OD600 0.6-0.8 using 0.5-1.0 mM IPTG

  • Temperature: Lower expression temperature (16-25°C) to enhance proper folding

  • Buffer composition during purification: Tris-based buffers (pH 7.5-8.0) with 50% glycerol for stability

For storage, maintaining the protein at -20°C for short-term and -80°C for long-term storage is recommended, with minimized freeze-thaw cycles to preserve activity .

What methods are most effective for studying AIM31's interaction with mitochondrial respiratory complexes?

Advanced methodological approaches for studying AIM31's interactions include:

  • Blue Native PAGE Analysis: Allows visualization of intact respiratory supercomplexes

  • Co-immunoprecipitation: Using tagged versions of AIM31 to pull down interacting partners

  • Proximity Labeling: BioID or APEX2 fusion proteins to identify nearby interacting proteins

  • Electron Microscopy: For structural analysis of AIM31-containing complexes

  • Oxygen Consumption Assays: To assess functional impact on respiration when AIM31 is manipulated

Research on homologous proteins suggests AIM31 may interact with cytochrome c oxidase (Complex IV) and cytochrome bc1 (Complex III), affecting the stability and assembly of respiratory supercomplexes .

How can researchers effectively generate and validate AIM31 knockout strains in V. polyspora?

Generation of AIM31 knockout strains in V. polyspora requires careful consideration of mitochondrial genome stability. A methodological approach includes:

  • CRISPR-Cas9 System Adaptation: Modified for yeast with appropriate PAM sites for AIM31

  • Homologous Recombination: Using selection markers flanked by homologous regions

  • Confirmation Methods:

    • PCR verification of successful gene deletion

    • Sequencing to confirm precise deletion boundaries

    • Western blotting to verify absence of protein

    • Phenotypic characterization including growth rates, respiratory capacity, and mitochondrial DNA stability

Researchers should verify knockouts by measuring the frequency of mitochondrial genome loss, which should be elevated in AIM31 null mutants compared to wild-type strains .

How does AIM31 contribute to mitochondrial inheritance patterns in V. polyspora?

AIM31's role in mitochondrial inheritance appears to be connected to maintenance of mitochondrial DNA stability. Based on studies of related proteins:

  • AIM31 may facilitate proper segregation of mitochondrial DNA during cell division

  • It potentially interacts with mitochondrial nucleoids, helping maintain mtDNA structural integrity

  • The protein may influence mechanisms of selective maternal inheritance of mitochondria

Research indicates that null mutants display reduced frequency of mitochondrial genome loss, suggesting AIM31 plays a complex role in mitochondrial inheritance that may include both stabilizing and regulated degradation functions .

What evolutionary insights can be gained from studying V. polyspora AIM31 in comparison to other yeast species?

Evolutionary analysis of AIM31 across yeast species provides insights into mitochondrial protein evolution:

  • V. polyspora, like other post-whole genome duplication (WGD) yeasts, shows evidence of gene duplication and divergence

  • Analysis of synteny and phylogeny reveals that V. polyspora possesses paralogs of certain mitochondrial genes that arose through WGD, similar to its tRNA synthetase genes

  • Comparison of nonsynonymous to synonymous substitution rates (dN/dS) between mitochondrial genes in V. polyspora and other species can reveal selection pressures on mitochondrial proteins

The evolutionary pattern of AIM31 appears similar to that observed in the alanyl-tRNA synthetase (AlaRS) genes of V. polyspora, which arose from a dual-functional common ancestor through WGD .

What mechanisms regulate the selective inheritance of mitochondria, and how might AIM31 be involved?

Selective inheritance of mitochondria involves several mechanisms:

  • Active Degradation: Paternal mitochondria often undergo self-destruction through endonuclease G activity, which degrades mitochondrial DNA shortly after fertilization

  • Membrane Integrity Loss: Paternal mitochondria lose inner membrane integrity, marking them for autophagy

  • Selective Ubiquitination: Marking specific mitochondria for degradation

AIM31 may participate in these processes by:

  • Maintaining structural integrity of mitochondrial membranes

  • Interacting with respiratory complexes to regulate mitochondrial function

  • Potentially influencing mitochondrial membrane potential, which affects mitochondrial quality control systems

Research in C. elegans has shown that paternal mitochondria actively initiate their own destruction by releasing endonuclease G to degrade the mitochondrial genome . The role of AIM31 in similar processes in yeast warrants further investigation.

How does the function of AIM31 compare with other mitochondrial proteins involved in respiratory complex formation?

AIM31 (also known as RCF1 in some species) functions comparatively with other mitochondrial proteins:

ProteinFunctionInteraction with Respiratory ComplexesEffect of Deletion
AIM31/RCF1Respiratory supercomplex factorComplexes III and IVReduced mitochondrial genome stability
Rcf2Respiratory supercomplex factorComplex IVDestabilized supercomplexes
Cox13Cytochrome c oxidase subunitComplex IVReduced Cox activity
Cor1Core subunit of bc1 complexComplex IIISeverely impaired respiration

The comparative analysis suggests AIM31 serves as a bridging factor that helps stabilize interactions between respiratory complexes, thereby optimizing electron transport chain efficiency .

What structural features does AIM31 share with other mitochondrial membrane proteins?

Structural analysis indicates AIM31 shares several key features with other mitochondrial membrane proteins:

  • Transmembrane Domains: Contains hydrophobic regions that span the mitochondrial membrane

  • Conserved Motifs: Shares specific sequence motifs with other respiratory complex assembly factors

  • Mitochondrial Targeting Signal: Contains N-terminal regions that direct the protein to mitochondria

  • Charged Residue Distribution: Typical asymmetric distribution of charged residues that orient the protein in the membrane

These structural similarities place AIM31 within a family of proteins that mediate interactions between larger respiratory complex subunits and contribute to supercomplex stability .

How can recombinant AIM31 be utilized to study mitochondrial recombination events?

Recombinant AIM31 can be employed as a tool to study mitochondrial recombination through several sophisticated approaches:

  • In vitro Reconstitution Systems: Using purified AIM31 with mitochondrial DNA and other factors to study recombination events

  • Fluorescently-Tagged AIM31: To track its localization during recombination events using high-resolution microscopy

  • AIM31 Mutant Libraries: Systematically altering domains to identify regions critical for mtDNA stability

  • Heterologous Expression: Expressing V. polyspora AIM31 in other yeast species to assess functional conservation

These approaches can help elucidate how AIM31 influences the frequency of mitochondrial genome recombination events, which are increasingly recognized as occurring in various species including humans .

What insights can the study of V. polyspora AIM31 provide for understanding human mitochondrial disorders?

The study of V. polyspora AIM31 has translational implications for human mitochondrial disorders:

  • Yeast mitochondrial proteins often have human homologs with conserved functions

  • Mechanisms of mitochondrial inheritance and quality control are partially conserved from yeast to humans

  • Understanding how AIM31 affects respiratory complex function could provide insights into human disorders caused by dysfunctional respiratory chains

  • The protein's role in mitochondrial genome stability may inform mechanisms of mitochondrial DNA deletions and rearrangements seen in human diseases

Recombinant TFAM (mitochondrial transcription factor A) with added protein transduction domains has shown promise in enhancing mitochondrial function in human cells with mitochondrial defects, suggesting similar approaches might be developed based on AIM31 research .

How do environmental stressors affect AIM31 expression and function in V. polyspora?

Environmental stress response of AIM31 can be studied using methodological approaches similar to those used for other stress-responsive mitochondrial genes:

  • Quantitative RT-PCR: To measure AIM31 expression under various stressors (oxidative stress, heat shock, nutrient limitation)

  • Proteomics: Mass spectrometry-based approaches to identify post-translational modifications of AIM31 under stress

  • Mitochondrial Functional Assays: Oxygen consumption, membrane potential, and ROS production in AIM31 mutants under stress

  • Genetic Interaction Screens: Identifying genes that become essential in combination with AIM31 deletion under stress

Research on V. polyspora glycyl-tRNA synthetase genes has shown that paralogs can have different responses to environmental stressors, with some being constitutively expressed and others induced by stress. AIM31 might show similar regulatory patterns .

What experimental design is most appropriate for characterizing AIM31's role in respiratory supercomplex assembly?

A comprehensive experimental design for characterizing AIM31's role in respiratory supercomplex assembly should include:

  • Genetic Approaches:

    • Creation of AIM31 deletion strains

    • Point mutations in key domains

    • Complementation studies with homologs from other species

  • Biochemical Methods:

    • Blue Native PAGE analysis of respiratory complexes

    • Activity assays for Complexes III and IV

    • Crosslinking studies to identify direct interaction partners

  • Structural Studies:

    • Cryo-EM analysis of supercomplexes with and without AIM31

    • Structural modeling based on homology with characterized proteins

  • Physiological Characterization:

    • Growth assays under fermentative and respiratory conditions

    • Oxygen consumption rates

    • Mitochondrial membrane potential measurements

    • ROS production analysis

This multi-faceted approach allows for comprehensive characterization of AIM31's functional role in supercomplex assembly and stability .

How can researchers accurately determine the subcellular localization and topology of AIM31 in the mitochondrial membrane?

Determining AIM31's precise subcellular localization and membrane topology requires combining multiple approaches:

  • Fluorescence Microscopy:

    • C- and N-terminal GFP fusions to determine general localization

    • Co-localization with known mitochondrial compartment markers

  • Biochemical Fractionation:

    • Submitochondrial fractionation to determine association with inner or outer membrane

    • Protease protection assays to determine which domains are exposed to each compartment

  • Topology Mapping:

    • Cysteine accessibility methods with membrane-permeable and impermeable reagents

    • Glycosylation mapping using engineered glycosylation sites

  • Electron Microscopy:

    • Immunogold labeling of AIM31 for high-resolution localization

These methods collectively provide comprehensive information about AIM31's precise location within mitochondrial subcompartments and its orientation within the membrane .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.