Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM36; FMP39; Kpol_1043p12; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
40-243
Protein Length
Full Length of Mature Protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
AIM36
Target Protein Sequence
SAGSSSSNNEIPGFGKIALVGVIGTYIFYKAAQSIDRNKPKEYVSEDEYNNVMSGLKRRV SIFKPDEVEIHLSPIKDVTKVKRLFRDDKQMIYIDPAKLAEQVRQDPEDPYEPLLEELVK KHGTEAYYDHLPFGMAAMLTGRYMKENCKAGDRIVVYNFPLNIQEAIKFENEISILKDIV VYKDDQSIDGVVSYYKTVKKVQEI
Uniprot No.

Target Background

Database Links
Protein Families
AIM36 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How does Vanderwaltozyma polyspora AIM36 compare structurally and functionally to homologs in other yeast species?

AIM36 belongs to a conserved family of mitochondrial proteins found across fungal species. Comparative analysis with homologs from other yeasts such as Saccharomyces cerevisiae, Lodderomyces elongisporus, and Candida species reveals conserved domains essential for mitochondrial function. While sequence identity varies between 45-70% depending on the species, functional domains involved in mitochondrial inheritance remain highly conserved. Researchers should consider this conservation when designing experiments that might translate findings across species .

What are the optimal conditions for reconstitution and storage of recombinant AIM36 protein?

For optimal results with recombinant AIM36:

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C/-80°C

To ensure protein stability, avoid repeated freeze-thaw cycles, as this significantly reduces activity. If using the protein for functional assays, consider buffer optimization with reducing agents to maintain structural integrity .

What experimental approaches are most effective for studying AIM36 localization and dynamics in mitochondria?

To effectively study AIM36 localization and dynamics:

TechniqueApplicationAdvantagesLimitations
Fluorescence microscopyLive-cell imaging of tagged AIM36Real-time dynamics visualizationPotential tag interference with function
Mitochondrial fractionationBiochemical localizationQuantitative assessment of distributionLoss of spatial information
MITO-ID® stainingCo-localization studiesNo protein modification requiredLimited temporal resolution
Immunogold electron microscopyHigh-resolution localizationPrecise submitochondrial localizationFixed samples only

For dynamic studies, combine fluorescently tagged AIM36 with membrane potential assays such as MITO-ID® to simultaneously monitor protein behavior and mitochondrial energetic status. This approach allows correlation between AIM36 dynamics and functional mitochondrial states .

How does AIM36 contribute to mitochondrial inheritance and what experimental approaches best demonstrate this function?

AIM36 (Altered inheritance of mitochondria protein 36) is implicated in regulating mitochondrial inheritance during cell division. To effectively demonstrate this function:

  • Generate knockout models using CRISPR-Cas9 in model organisms

  • Employ time-lapse microscopy with fluorescently labeled mitochondria to track inheritance patterns

  • Utilize mitochondrial membrane potential assays to assess functional consequences

  • Perform complementation studies with wild-type and mutant AIM36 variants

Recent studies suggest that AIM36 may function in conjunction with other mitochondrial proteins to ensure proper segregation of mitochondria during cell division. Research indicates potential interactions with mitochondrial fission/fusion machinery, which can be assessed through co-immunoprecipitation experiments followed by mass spectrometry to identify binding partners .

What role might AIM36 play in mitochondrial quality control and mitophagy?

Current research suggests AIM36 may function in mitochondrial quality control pathways. To investigate this:

  • Examine co-localization with mitophagy markers (LC3, p62) under stress conditions

  • Measure mitochondrial turnover rates in AIM36-depleted vs. control cells

  • Assess mitochondrial morphology changes using electron microscopy

  • Analyze mitochondrial proteome alterations using quantitative proteomics

Evidence from studies on mitochondrial disorders highlights the importance of quality control mechanisms in maintaining mitochondrial function. Based on patterns observed in other mitochondrial proteins, AIM36 might participate in recognizing damaged mitochondria or facilitating their removal through mitophagy pathways .

How might genome editing approaches be optimized for studying AIM36 function in various model systems?

For optimal genome editing of AIM36:

  • CRISPR-Cas9 Standard Editing: Design sgRNAs targeting conserved regions of AIM36 with minimal off-target effects, preferably in exonic regions encoding functional domains.

  • Prime Editing Approach: For subtle mutations without double-strand breaks:

    • Design pegRNAs targeting specific AIM36 sequences

    • Utilize PE3 system for higher editing efficiency

    • Verify edits through deep sequencing to ensure precision

  • AAV-Mediated Delivery for in vivo Applications:

    • For tissues with limited accessibility, consider dual or triple AAV systems

    • Trans-splicing approach can overcome size limitations of delivery vectors

Optimize transfection/transduction conditions based on the specific cell type or organism being studied. For yeast models, consider integration at the endogenous locus for physiological expression patterns. In mammalian systems, carefully evaluate editing efficiency across different cell types .

What are the methodological challenges in correlating AIM36 dysfunction with mitochondrial disease phenotypes?

Investigating AIM36's role in disease contexts presents several methodological challenges:

  • Phenotypic Variability: Despite identical genetic mutations, mitochondrial diseases often present with variable phenotypes. Control experiments must account for this variability through:

    • Large sample sizes

    • Detailed phenotypic characterization

    • Multi-parameter analysis of mitochondrial function

  • Tissue-Specific Effects: AIM36 dysfunction may manifest differently across tissues:

    • Design experiments to compare effects in different cell types

    • Consider tissue-specific conditional knockout models

    • Develop organoid models for human-relevant contexts

  • Causality vs. Correlation: Distinguishing whether AIM36 abnormalities are causative or consequential requires:

    • Temporal studies to establish sequence of events

    • Rescue experiments with wild-type protein

    • Dose-dependent analysis of phenotype severity

  • Biomarker Development: For translational research, establish reliable biomarkers:

    • Identify mitochondrial parameters that correlate with AIM36 dysfunction

    • Validate across multiple model systems

    • Develop high-throughput assays for screening interventions

How does studying AIM36 contribute to our understanding of mitochondrial OXPHOS defects and neurodegenerative diseases?

Research on AIM36 has significant implications for understanding broader mitochondrial dysfunction:

  • Mitochondrial Complex III Dynamics: Evidence suggests Complex III dysfunction plays a role in neurodegenerative diseases. AIM36 studies may reveal novel regulatory mechanisms affecting Complex III assembly or function.

  • Oxidative Stress Pathways: The relationship between mitochondrial membrane proteins and ROS production can be elucidated through AIM36 research, particularly by:

    • Measuring oxidized nucleic acids in AIM36-depleted cells

    • Assessing antioxidant responses in different cellular compartments

    • Correlating AIM36 levels with markers of oxidative damage

  • Translational Research Applications: Findings from AIM36 studies can inform:

    • Development of mitochondria-targeted antioxidants

    • Design of gene therapy approaches for mitochondrial disorders

    • Identification of novel biomarkers for disease progression

Methodologically, researchers should employ multiple complementary approaches to assess OXPHOS function, including spectrophotometric enzyme assays, high-resolution respirometry, and in situ visualization of respiratory complexes .

What are the most significant technical challenges in isolating functional AIM36 protein for structural studies?

Obtaining properly folded, functional AIM36 for structural studies presents several challenges:

  • Membrane Protein Solubility: As a mitochondrial membrane-associated protein, AIM36 requires:

    • Optimization of detergent types and concentrations

    • Consideration of lipid nanodisc approaches

    • Careful buffer optimization to maintain native conformation

  • Post-Translational Modifications: Any functionally relevant PTMs must be preserved:

    • Compare eukaryotic vs. prokaryotic expression systems

    • Analyze modification patterns in native vs. recombinant protein

    • Consider site-directed mutagenesis to mimic constitutive modifications

  • Functional Validation: Before structural studies, confirm protein functionality:

    • Develop activity assays relevant to AIM36's role in mitochondria

    • Assess proper folding through circular dichroism or limited proteolysis

    • Verify interaction with known binding partners

  • Structural Approaches: Based on protein properties, select appropriate methods:

    • X-ray crystallography for stable domains

    • Cryo-EM for larger complexes

    • NMR for dynamic regions and interaction studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.