Recombinant Vanderwaltozyma polyspora Altered inheritance of mitochondria protein 39, mitochondrial (AIM39)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Vanderwaltozyma polyspora Altered Inheritance of Mitochondria Protein 39, Mitochondrial (AIM39)

Recombinant Vanderwaltozyma polyspora Altered Inheritance of Mitochondria Protein 39, Mitochondrial (AIM39), is a protein of interest in the field of molecular biology, particularly in the study of mitochondrial function and inheritance. Despite the lack of specific literature directly focused on this protein, understanding its role requires an exploration of related proteins and pathways. This article aims to provide an overview of AIM39 based on available data and related research findings.

Potential Functions and Pathways

  • FMP25: Involved in the assembly of respiratory complex III, highlighting the importance of mitochondrial inner membrane proteins in energy metabolism .

  • RML2: A mitochondrial ribosomal protein, indicating the role of ribosomal components in mitochondrial translation .

Table: Potential Pathways and Related Proteins

Pathway/FunctionRelated Proteins
Respiratory Complex AssemblyFMP25, COR1, COX11
Mitochondrial TranslationRML2
Redox RegulationAim32, Osm1

Research Findings and Implications

While specific research findings on AIM39 are not available, studies on related proteins suggest that these proteins are crucial for maintaining mitochondrial integrity and function. For example, Aim32 is essential for growth under stress conditions and plays a role in redox homeostasis . The study of AIM proteins, including AIM39, could provide insights into how mitochondria adapt to stress and how these adaptations impact cellular health.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped on blue ice unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize your request.
Synonyms
AIM39; Kpol_480p24; Altered inheritance of mitochondria protein 39, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-345
Protein Length
Full Length of Mature Protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
AIM39
Target Protein Sequence
SNDSKYFFSKPPANDNNDKGSYADSKHFFTKPNGKMNSNEQIDQMHNNGSNNPNNNKNGS TDSLIGQAILQQRRERRKQVWYALGISIFAVLIGYSIGYKVIYLNEDSFIPLYPSSGIRK PSQNDLRKIDVPHIKLISHLRVLEVLSHHDMIKEQYGVPLHDSNGVNPPQIKEFNIWCED QDPCVTGLIIRKDDPNRPTTHTWHRIPYLLQWRVTHRPICISRSISNFLEDIGLSYSTIY EIISPEKIYGSFKYEYPIPGDDHSMHIWFLGELQLNNDTLIIYKGKYHVDVKLQQVDLLR NEDGKLVRYVLFKENE
Uniprot No.

Target Background

Database Links
Protein Families
AIM39 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is AIM39 and what are its fundamental characteristics?

AIM39 is a mitochondrial protein identified in Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294), also known as Kluyveromyces polysporus, a species of ascomycetous yeast in the family Saccharomycetaceae . The protein has a UniProt accession number A7TP86 and is characterized as part of the "Altered inheritance of mitochondria" protein family . The full amino acid sequence consists of 345 amino acids with specific functional domains that suggest involvement in mitochondrial inheritance and possibly redox control mechanisms, similar to other AIM family proteins .

How should recombinant AIM39 be properly stored and handled in laboratory settings?

For optimal stability and activity, recombinant AIM39 should be stored in Tris-based buffer containing 50% glycerol at -20°C, with extended storage recommended at -80°C . Working aliquots can be maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and function . When handling the protein, consider that it has specific buffer requirements optimized to maintain its native conformation and activity. Unlike some other recombinant proteins that may tolerate various buffer conditions, AIM39's mitochondrial origin makes it particularly sensitive to storage conditions .

What experimental techniques are most effective for studying AIM39's subcellular localization?

To accurately determine AIM39's subcellular localization, researchers should implement a multi-method approach:

  • Subcellular Fractionation with Immunoblotting: This technique involves isolating mitochondria followed by separation of mitochondrial compartments (outer membrane, intermembrane space, inner membrane, and matrix) through differential centrifugation or osmotic shock protocols. Western blotting using AIM39-specific antibodies can then determine its precise submitochondrial location .

  • Fluorescence Microscopy with Compartment Markers: Expression of AIM39 tagged with fluorescent proteins (GFP or mCherry) in combination with established mitochondrial compartment markers can visualize localization in living cells. Based on studies of AIM32, which shows dual localization to both matrix and IMS, researchers should be prepared to analyze complex distribution patterns .

  • Protease Protection Assays: This approach helps distinguish between proteins exposed to the IMS versus those protected in the matrix. Isolated mitochondria are treated with proteases (e.g., trypsin or proteinase K) with or without membrane permeabilization, followed by detection of AIM39 fragments by immunoblotting .

TechniqueAdvantagesLimitationsControls Required
Subcellular FractionationQuantitative, biochemical confirmationPotential cross-contaminationCompartment marker proteins
Fluorescence MicroscopyVisualization in living cells, dynamic studiesResolution limitationsCo-localization markers
Protease ProtectionPrecise topological informationRequires optimal protease conditionsKnown IMS and matrix proteins

How can researchers effectively express and purify recombinant AIM39 for structural studies?

Based on current recombinant protein production approaches for mitochondrial proteins, a systematic expression and purification strategy includes:

  • Expression System Selection: While E. coli is commonly used, yeast expression systems like Pichia pastoris may provide better folding for mitochondrial proteins. For AIM39, consider using the native Vanderwaltozyma polyspora or related Saccharomycetaceae species for homologous expression .

  • Construct Design: Include the complete coding sequence (amino acids 30-345) without the mitochondrial targeting sequence to improve solubility. Consider adding affinity tags that can be cleaved post-purification using specific proteases .

  • Purification Protocol:

    • Affinity chromatography (Ni-NTA for His-tagged constructs)

    • Ion exchange chromatography to separate charge variants

    • Size exclusion chromatography for final polishing

    • Maintain reducing conditions throughout purification with agents like DTT or β-mercaptoethanol to protect cysteine residues

  • Quality Control: Assess purity by SDS-PAGE, protein identity by mass spectrometry, and proper folding by circular dichroism. For AIM39, functional assays related to its potential redox activity should be developed based on approaches used for AIM32 .

What methodologies are appropriate for investigating AIM39's potential role in redox processes?

Drawing from studies on AIM32, which functions in redox quality control, several approaches can be adapted for AIM39:

  • Thiol-Trapping Assays: To detect the redox state of cysteine residues in AIM39, researchers can use alkylating agents such as iodoacetamide or N-ethylmaleimide followed by non-reducing SDS-PAGE to visualize different redox forms .

  • Protein-Protein Interaction Studies Under Varying Redox Conditions:

    • Co-immunoprecipitation experiments under normal and oxidative stress conditions

    • Proximity labeling techniques (BioID or APEX) to identify redox-dependent interactors

    • Yeast two-hybrid screening with redox-sensitive mitochondrial proteins

  • Functional Complementation: Testing whether AIM39 can rescue phenotypes of AIM32-deficient yeast strains under oxidative stress conditions, particularly examining:

    • Growth under elevated temperature (37-39°C)

    • Sensitivity to hydroxyurea

    • Growth under anaerobic conditions

  • Fe-S Cluster Analysis: If AIM39 contains Fe-S clusters similar to AIM32, use UV-visible spectroscopy, electron paramagnetic resonance (EPR), and Mössbauer spectroscopy to characterize the iron-sulfur centers and their redox properties .

How can mitochondrial base editing techniques be applied to study AIM39 function in disease models?

Recent advances in mitochondrial base editing (mitoBE) offer powerful approaches to study AIM39's function:

  • Targeted Mutation Introduction: Using optimized mitoBEs (version 2), researchers can introduce precise mutations in the AIM39 gene with up to 82% editing efficiency. This approach allows creation of animal models that mimic potential disease-causing variants while minimizing off-target effects .

  • Maternal Inheritance Studies: Since edited mitochondrial DNA can be maternally inherited, researchers can establish stable animal lines with AIM39 mutations. The F1 generation mice can achieve mutation loads as high as 100%, enabling studies of AIM39 dysfunction across multiple generations .

  • Tissue-Specific Phenotype Analysis: As edited mitochondrial DNA persists across various tissues, researchers can analyze tissue-specific effects of AIM39 mutations, particularly in tissues with high mitochondrial density such as heart, muscle, and neurons .

  • Transcription Activator-Like Effector (TALE) Optimization: By optimizing TALE binding sites, researchers can enhance the specificity of base editing for AIM39, following the approach used successfully for mt-Nd5 and mt-Atp6 genes .

Advantage of mitoBE ApproachApplication to AIM39 ResearchPotential Research Question
High editing efficiencyCreate precise mutations in AIM39How do specific AIM39 mutations affect mitochondrial inheritance?
Maternal inheritanceEstablish stable animal linesIs AIM39 dysfunction progressively worsened across generations?
Multi-tissue analysisCompare tissue-specific effectsAre certain tissues more susceptible to AIM39 dysfunction?
Minimal off-target effectsIsolate AIM39-specific phenotypesWhat are the direct consequences of AIM39 mutations versus secondary effects?

What is the evolutionary conservation of AIM39 across yeast species and its implications for research?

Understanding the evolutionary conservation of AIM39 provides insights into its functional importance:

  • Comparative Genomic Analysis: AIM39 is present in Vanderwaltozyma polyspora, which belongs to the Saccharomycetaceae family. This family includes 7 known species of Vanderwaltozyma and many other yeast genera . Researchers should:

    • Compare AIM39 sequences across all 7 Vanderwaltozyma species

    • Identify orthologs in related yeast genera

    • Map conserved domains and residues

  • Functional Complementation Studies: Test whether AIM39 from different species can complement each other's function, particularly focusing on:

    • V. polyspora AIM39 vs. V. yarrowii AIM39

    • Complementation between Vanderwaltozyma AIM39 and related proteins in Saccharomyces species

  • Structural Conservation Analysis: Using bioinformatic tools, predict structural features of AIM39 across species to identify:

    • Conserved functional domains

    • Species-specific adaptations

    • Potential correlation with ecological niches of different yeast species

What experimental approaches can identify protein-protein interactions of AIM39 in mitochondria?

To elucidate AIM39's interaction network, researchers should consider these complementary approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged AIM39 in Vanderwaltozyma polyspora or a model organism like S. cerevisiae

    • Perform pull-down experiments under various conditions (normal, oxidative stress, nutrient limitation)

    • Identify binding partners through mass spectrometry

    • Validate with reciprocal tagging of identified interactors

  • Yeast Two-Hybrid Screening with Mitochondrial Library:

    • Use a split-ubiquitin system optimized for membrane and mitochondrial proteins

    • Screen against a library of known mitochondrial proteins

    • Validate interactions using bimolecular fluorescence complementation (BiFC)

  • Proximity-Based Labeling:

    • Fuse AIM39 to BioID or APEX2 enzymes

    • Express in cells and activate labeling

    • Identify nearby proteins through streptavidin pull-down and mass spectrometry

    • Map the spatial organization of AIM39 within mitochondrial compartments

  • Co-immunoprecipitation Under Different Redox Conditions:

    • Perform immunoprecipitations under normal and oxidized conditions

    • Identify redox-dependent interactions

    • Map interaction sites through directed mutagenesis of cysteine residues

Based on studies of AIM32, researchers should particularly investigate potential interactions with:

  • Components of the mitochondrial import machinery (TIM complexes)

  • Redox-regulating proteins (similar to Erv1 and Osm1)

  • Other AIM family proteins

  • Proteins involved in Fe-S cluster biogenesis

How might AIM39 contribute to the broader network of proteins involved in mitochondrial quality control?

Based on research with AIM32 and other mitochondrial proteins, AIM39 likely functions within a complex quality control network:

  • Redox Homeostasis Integration:

    • May interact with sulfhydryl oxidases like Erv1 in the intermembrane space

    • Could function as a sensor of redox status through potential Fe-S clusters

    • May target cysteine residues sensitive to oxidation in various mitochondrial proteins

  • Protein Import Machinery Connection:

    • Potential role in maintaining the redox status of import components like TIM complexes

    • May facilitate proper assembly of protein import complexes

    • Could be involved in quality control of imported proteins with aberrant disulfide bonds

  • Stress Response Pathway:

    • Likely essential for growth under stress conditions similar to AIM32

    • May be critical during temperature stress, oxidative stress, or anaerobic conditions

    • Could function as a mitochondrial stress sensor

  • Dual Compartment Coordination:

    • If dual-localized like AIM32, could coordinate redox status between matrix and intermembrane space

    • May facilitate communication between different mitochondrial compartments

    • Could be involved in sensing imbalances between compartments

What are the most promising research applications for recombinant AIM39 in mitochondrial disease studies?

Recombinant AIM39 offers several valuable applications for mitochondrial disease research:

  • Biomarker Development:

    • As a potential redox sensor, changes in AIM39 levels or modifications could serve as biomarkers for mitochondrial dysfunction

    • Develop antibodies against specific redox forms of AIM39 for diagnostic applications

    • Correlate AIM39 status with disease progression in mitochondrial disorder models

  • Drug Screening Platform:

    • Use purified recombinant AIM39 to screen for small molecules that modulate its activity

    • Develop cell-based assays where AIM39 function can be monitored

    • Identify compounds that restore redox balance in models of mitochondrial dysfunction

  • Therapeutic Protein Development:

    • Engineer modified versions of AIM39 with enhanced stability or activity

    • Develop methods for mitochondrial delivery of functional AIM39

    • Test whether supplementation with functional AIM39 can rescue disease phenotypes

  • Precision Medicine Models:

    • Create patient-specific variants of AIM39 using mitochondrial base editing

    • Test responses to treatments in models with different genetic backgrounds

    • Develop personalized therapeutic approaches based on specific mitochondrial mutations

What methodological challenges exist in studying AIM39 and how can researchers address them?

Several technical challenges must be overcome for effective AIM39 research:

  • Protein Stability and Solubility Issues:

    • Challenge: Mitochondrial proteins like AIM39 often form inclusion bodies when overexpressed

    • Solution: Optimize expression conditions with lower temperatures (16-18°C), use solubility tags (SUMO, MBP), or employ specialized yeast expression systems

  • Maintaining Native Redox Environment:

    • Challenge: AIM39 likely contains redox-sensitive elements that are difficult to maintain in vitro

    • Solution: Employ anaerobic purification techniques, use reducing agents appropriately, and develop assays that can function under physiologically relevant redox conditions

  • Complex Submitochondrial Localization:

    • Challenge: If dual-localized like AIM32, separating functions in different compartments is difficult

    • Solution: Create compartment-specific variants with targeted localization signals, use inducible expression systems to control timing of expression

  • Functional Redundancy with Other AIM Proteins:

    • Challenge: Overlapping functions may mask phenotypes in single-gene studies

    • Solution: Create double or triple mutants, use conditional expression systems, employ synthetic genetic array approaches to identify genetic interactions

  • Translation Between Model Systems and Human Disease:

    • Challenge: Yeast mitochondrial proteins may have divergent functions from human orthologs

    • Solution: Identify human orthologs of AIM39, perform complementation studies, and validate findings in mammalian cell lines and animal models using mitochondrial base editors

ChallengeMethodological SolutionTechnical Considerations
Protein stabilityOptimization of expression systemsTemperature, pH, buffer composition, solubility tags
Redox sensitivityAnaerobic techniquesGlove box systems, reducing agents, rapid analysis
Compartment specificityTargeted localization variantsSpecific targeting sequences, inducible systems
Functional redundancyMulti-gene approachCRISPR-based multiplexing, synthetic genetic arrays
Cross-species translationComplementation studiesHuman cell lines, animal models with base editing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.