Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6) is a full-length mitochondrial protein encoded by the ATP6 gene in the yeast Vanderwaltozyma polyspora. This protein forms a critical subunit of the F₀ sector of ATP synthase (Complex V), essential for proton translocation during oxidative phosphorylation. The recombinant version is expressed in E. coli with an N-terminal His-tag for purification and structural studies .
| Parameter | Detail |
|---|---|
| Gene Name | ATP6 (VapofMp08) |
| Synonyms | ATP synthase subunit 6, F-ATPase protein 6 |
| UniProt ID | A6H4Q8 |
| Species | Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) |
| Expression Host | E. coli |
| Tag | N-terminal His-tag |
| Protein Length | Full-length mature protein (6–254 amino acids) |
| Purity | >90% (SDS-PAGE verified) |
The full-length sequence includes hydrophobic regions critical for membrane integration:
SPLDQFEMNTLLKFVTPFFDMSNLNITTFGLYIIIVLMVIVSLNILTTNNNTIIGSRWNL... (partial sequence; full sequence provided in ).
ATP6 is part of the F₀ proton channel, enabling:
Proton translocation across the mitochondrial inner membrane.
Energy coupling to ADP→ATP conversion in the F₁ catalytic domain .
In V. polyspora, ATP6 is regulated by PPR proteins (e.g., Atp22p), which stabilize its mRNA and facilitate translation . Mutations in ATP6 homologs (e.g., human MT-ATP6) are linked to mitochondrial disorders like Leigh syndrome .
Evolutionary Insights: V. polyspora ATP6 diverged from a dual-functional ancestor via whole-genome duplication, with mitochondrial isoforms evolving faster due to relaxed selection .
PPR Protein Interactions: Atp22p stabilizes ATP6 mRNA and enhances translation efficiency in V. polyspora .
Structural Adaptations: His-tagged ATP6 enables high-yield purification for biophysical studies .
Creative BioMart. Recombinant Full Length Vanderwaltozyma Polyspora ATP Synthase Subunit A (ATP6) Protein, His-Tagged. RFL7117VF.
MedlinePlus Genetics. MT-ATP6 Gene. MT-ATP6.
Lipinski et al. Revisiting the Yeast PPR Proteins. PMC4456443.
Wang et al. Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora. PMC1133750.
MyBioSource. Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6).522847.
Wikipedia. MT-ATP6. MT-ATP6.
PMC. Divergent Alanyl-tRNA Synthetase Genes. PMC4456443.
GeneBioSystems. Recombinant Vanderwaltozyma polyspora ATP synthase subunit a. Product Page.
PMC. Diminished Synthesis of Subunit a (ATP6). PMC1133750.
Wikipedia. Vanderwaltozyma. Vanderwaltozyma.
KEGG: vpo:VapofMp08
ATP synthase subunit a (ATP6) is an essential component of the F₁F₀-ATP synthase complex, which catalyzes the synthesis of ATP from ADP and inorganic phosphate (Pi) as the final step of the oxidative phosphorylation pathway. The ATP synthase complex consists of 16 different subunits and is composed of a globular F₁ catalytic part connected by two stalks to the membrane-embedded F₀ moiety that translocates protons across the mitochondrial inner membrane . Subunit a is one of only two F₀ subunits encoded by mitochondrial DNA (mtDNA), the other being A6L (ATP8) .
The specific function of subunit a is to form part of the proton channel along with multiple copies of subunit c. This channel is crucial for the rotary mechanism of ATP synthesis, as it converts the proton motive force across the inner mitochondrial membrane into mechanical energy that drives ATP production . Mutations in the ATP6 gene can disturb the function of this proton channel, often leading to severe mitochondrial encephalopathies .
Studying V. polyspora ATP6 offers valuable evolutionary insights into mitochondrial gene conservation and adaptation. V. polyspora represents an interesting model organism as it underwent whole-genome duplication (WGD), leading to divergent evolution of some gene pairs . While the search results don't specifically mention ATP6 gene duplication in V. polyspora, the evolutionary patterns observed in its other mitochondrially-related genes like AlaRS could provide comparative frameworks.
The study of ATP6 in V. polyspora could reveal how critical mitochondrial components evolve under different selection pressures, particularly in organisms that have undergone genome duplication events. Such research might illuminate the balance between conservation of essential function and adaptation to specific environmental niches or metabolic requirements.
Cloning and expressing V. polyspora ATP6 requires careful consideration of its mitochondrial origin and membrane protein nature. Based on approaches used for similar V. polyspora genes, the following methodology is recommended:
Gene Amplification:
Design gene-specific primers with appropriate restriction sites (e.g., EagI for forward primer and XhoI for reverse primer)
The forward primer should be located approximately 300 bp upstream of the first ATG codon
The reverse primer should be positioned immediately upstream of the stop codon
Use high-fidelity polymerase for PCR amplification using genomic DNA as template
Vector Selection and Preparation:
Transformation and Expression:
Transform the construct into an appropriate host (S. cerevisiae can be used as a heterologous expression system)
For optimal expression of membrane proteins, consider specialized yeast strains designed for membrane protein production
This approach enables expression of the recombinant protein while maintaining its native regulatory elements, which is crucial for functional studies .
Purification and stabilization of recombinant V. polyspora ATP6 presents challenges due to its hydrophobic nature as a membrane protein. The following protocol is recommended:
Storage and Handling of Expressed Protein:
Membrane Protein Extraction:
Disrupt cells using methods that preserve membrane protein integrity (e.g., glass bead homogenization or enzymatic spheroplasting)
Use gentle detergents like digitonin (0.1 mg detergent/mg protein) for initial solubilization
For complete solubilization, consider stronger detergents such as DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol)
Purification Strategy:
Stabilization Approaches:
Maintain critical lipids from the native environment
Consider nanodiscs or amphipols for long-term stability
Use glycerol (10-15%) in storage buffers to prevent aggregation
These methods help maintain the structural integrity and functional activity of the recombinant protein for downstream applications.
Multiple complementary analytical techniques should be employed to thoroughly assess the functional integrity of recombinant V. polyspora ATP6:
ATP Hydrolysis Assays:
Measure ATPase activity using a coupled enzyme assay that monitors NADH oxidation
Conduct assays in buffer containing 40 mM Tris-HCl (pH 7.4), 5 mM MgCl₂, 10 mM KCl, 2 mM phosphoenolpyruvate, 0.2 mM NADH, with pyruvate kinase and lactate dehydrogenase
Initiate reaction with 1 mM ATP and monitor the decrease in absorbance at 340 nm
Include control measurements with 2 μM aurovertin to assess specific inhibition
Proton Translocation Measurements:
Assess proton pumping activity using pH-sensitive fluorescent dyes or electrodes
Reconstitute the protein into liposomes for these functional assays
Structural Analysis:
Respiration Measurements:
| Analytical Technique | Purpose | Key Parameters |
|---|---|---|
| ATP Hydrolysis Assay | Measure catalytic activity | Aurovertin-sensitive activity, Km for ATP |
| Proton Translocation | Assess proton channel function | Rate of proton movement, membrane potential |
| Blue-Native PAGE | Evaluate complex assembly | Complex stability, subcomplex formation |
| Western Blotting | Detect protein expression | Expression level, comparison with other subunits |
| Respirometry | Assess integrated function | ADP-stimulated respiration, coupling efficiency |
These techniques provide complementary information about both the structural integrity and functional capacity of the recombinant protein.
Site-directed mutagenesis of V. polyspora ATP6 represents a powerful approach to dissect the molecular mechanisms of proton translocation. Based on knowledge from studies of ATP6 mutations in other organisms, the following strategy is recommended:
Target Selection for Mutagenesis:
Focus on conserved residues in transmembrane regions that likely contribute to the proton channel
Consider targeting residues analogous to those implicated in human mitochondrial diseases (e.g., positions corresponding to human L156 which, when mutated to R or P, causes NARP or MILS)
Design mutations that alter charge, hydrophobicity, or hydrogen-bonding capacity
Functional Analysis of Mutants:
Evaluate ATP synthesis capacity of each mutant using luciferin/luciferase assays
Compare ATP hydrolysis rates to identify mutations that specifically affect synthesis without altering hydrolysis
Measure proton translocation efficiency using pH-sensitive probes
Assess structural integrity using BN-PAGE to identify mutations that compromise complex assembly versus those that specifically affect proton movement
Data Interpretation Framework:
Develop a structure-function map correlating specific amino acid positions with functional outcomes
Use molecular dynamics simulations to model the effects of mutations on proton path and protein dynamics
Compare findings with known disease-causing mutations in human ATP6 to establish evolutionary conservation of critical functional domains
Understanding the species-specific aspects of ATP synthase assembly and function requires comparative analysis between V. polyspora and other yeast species:
Assembly Pathway Analysis:
Compare the subunit composition and assembly intermediates using BN-PAGE and two-dimensional electrophoresis across species
Identify whether V. polyspora shows unique assembly factors or chaperones compared to S. cerevisiae
Assess the stability of assembled complexes under various detergent and salt conditions to determine species-specific structural robustness
Functional Comparison:
Evolutionary Adaptation Assessment:
Correlate functional differences with the ecological niche and metabolic requirements of V. polyspora
Consider whether genome duplication events in V. polyspora have influenced ATP synthase evolution through subfunctionalization or neofunctionalization
Examine whether patterns of asymmetric evolution seen in other V. polyspora genes (like AlaRS) extend to components of the ATP synthase complex
This comparative approach can reveal how evolutionary pressures have shaped species-specific adaptations in this fundamental bioenergetic complex.
Researchers frequently encounter challenges when working with recombinant ATP6 due to its hydrophobic nature and mitochondrial origin. Here are common issues and their solutions:
Low Expression Levels:
Problem: ATP6 as a membrane protein often expresses poorly in heterologous systems.
Solutions:
Optimize codon usage for the expression host
Use stronger promoters while maintaining proper regulation
Consider fusion tags that can enhance folding and stability
Explore specialized yeast strains designed for membrane protein expression
Protein Misfolding and Aggregation:
Problem: Hydrophobic membrane proteins tend to aggregate during expression.
Solutions:
Lower the expression temperature (20-25°C)
Add specific lipids to the growth medium
Express as part of the entire ATP synthase complex rather than in isolation
Include chemical chaperones in the growth medium (e.g., glycerol, trimethylamine N-oxide)
Poor Solubilization:
Problem: Inefficient extraction from membranes.
Solutions:
Protein Instability During Storage:
These optimization strategies can significantly improve the yield and quality of recombinant V. polyspora ATP6 for research applications.
Inconsistent results in functional assays can arise from multiple sources. The following troubleshooting guide addresses common issues:
Variable ATP Hydrolysis Activity:
Problem: Inconsistent readings in ATPase activity assays.
Troubleshooting:
Verify enzyme coupling system components (pyruvate kinase, lactate dehydrogenase) are fresh and active
Ensure consistent protein-to-detergent ratios across experiments
Control for contaminating ATPases using specific inhibitors (oligomycin for F-type ATPases, aurovertin at 2 μM)
Standardize protein quantification methods
Measure both in the presence and absence of inhibitors to determine specific activity
Poor Correlation Between ATP Synthesis and Hydrolysis:
Problem: ATP synthesis capacity doesn't correlate with hydrolysis rates.
Troubleshooting:
Inconsistent Complex Assembly:
Problem: Variable patterns in BN-PAGE analysis.
Troubleshooting:
Standardize solubilization conditions
Control for sample oxidation by including reducing agents
Ensure consistent detergent-to-protein ratios
Compare patterns with known controls from other species or mutants
Consider that altered patterns may reflect physiologically relevant subcomplexes rather than experimental artifacts
Data Interpretation Framework:
Problem: Difficulty distinguishing experimental variation from biological significance.
Approach:
Establish clear positive and negative controls for each assay
Perform sufficient biological and technical replicates
Use statistical approaches appropriate for the data distribution
Consider integrating multiple assay types for a comprehensive assessment
This systematic troubleshooting approach can help identify sources of variability and improve data consistency and reliability.
Designing rigorous comparative experiments between wild-type and mutant ATP6 requires careful attention to multiple factors:
Experimental Design Principles:
Ensure isogenic backgrounds between wild-type and mutant strains
Control for expression levels by using the same promoter and vector system
Include positive and negative controls in each experiment
Perform experiments in a blinded fashion when possible
Design experiments with sufficient statistical power (minimum n=3 biological replicates)
Comprehensive Functional Assessment:
Evaluate multiple functional parameters:
Compare results across assays to develop a complete functional profile
Controls and Validation:
Include established mutants with known phenotypes as reference points
Verify that observed defects are specifically due to the introduced mutation by:
Complementation studies with wild-type protein
Creating and testing revertant mutations
Assessing the effect of the mutation in different genetic backgrounds
Data Analysis Framework:
Use appropriate statistical tests for each data type
Consider developing a scoring system that integrates multiple parameters
Establish clear thresholds for defining functional defects
Create visualization tools that effectively communicate the multidimensional nature of the data
| Parameter | Wild-Type Measurement | Mutant Measurement | Statistical Analysis |
|---|---|---|---|
| ATP Synthesis Rate | X nmol/min/mg | Y nmol/min/mg | t-test or ANOVA |
| ATP Hydrolysis | Z nmol/min/mg | W nmol/min/mg | t-test or ANOVA |
| Aurovertin Sensitivity | % inhibition | % inhibition | t-test |
| Complex Assembly | BN-PAGE pattern | BN-PAGE pattern | Qualitative comparison |
| Respiratory Rate | O₂ consumption | O₂ consumption | t-test or ANOVA |
This comprehensive approach ensures that comparisons between wild-type and mutant forms yield reliable, interpretable data that can advance understanding of structure-function relationships in ATP6.
Cryo-electron microscopy (cryo-EM) represents a revolutionary approach for studying membrane protein complexes like ATP synthase. For V. polyspora ATP synthase research, cryo-EM offers several advantages:
Cryo-EM approaches have the potential to provide unprecedented insights into the molecular mechanisms of ATP synthase function and the specific role of ATP6 in this essential bioenergetic complex.
Integrative omics approaches can reveal the broader biological context of ATP6 function in V. polyspora:
These omics approaches can provide a systems-level understanding of ATP6 function and regulation in the broader context of cellular metabolism and adaptation.
Synthetic biology approaches utilizing V. polyspora ATP6 offer exciting possibilities for bioenergetic engineering:
ATP Synthase Optimization:
Engineer ATP6 variants with enhanced coupling efficiency
Design ATP synthase complexes with altered ion specificity (H⁺ vs. Na⁺)
Create chimeric ATP synthases combining features from different species for optimal performance
Develop ATP synthases with resistance to inhibitors or environmental stressors
Biotechnological Applications:
Creation of yeast strains with enhanced ATP production for industrial fermentations
Development of biosensors based on ATP synthase function for monitoring cellular energetics
Engineering of artificial organelles with custom-designed ATP synthases
Integration of engineered ATP synthases into biohybrid systems for energy conversion
Methodological Approaches:
Directed evolution of ATP6 for specific functional properties
Rational design based on structural information and computational modeling
Development of high-throughput screening systems for ATP synthase function
Creation of minimal ATP synthase systems with reduced complexity
Potential Impact Areas:
Biofuel production optimization
Enhancement of industrial fermentation processes
Development of new approaches for treating mitochondrial diseases
Creation of bio-inspired energy conversion systems
Synthetic biology approaches using V. polyspora ATP6 could lead to both fundamental insights into bioenergetic principles and practical applications in biotechnology and medicine.