Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6) is a full-length mitochondrial protein encoded by the ATP6 gene in the yeast Vanderwaltozyma polyspora. This protein forms a critical subunit of the F₀ sector of ATP synthase (Complex V), essential for proton translocation during oxidative phosphorylation. The recombinant version is expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Gene and Protein Information

ParameterDetail
Gene NameATP6 (VapofMp08)
SynonymsATP synthase subunit 6, F-ATPase protein 6
UniProt IDA6H4Q8
SpeciesVanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294)
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length mature protein (6–254 amino acids)
Purity>90% (SDS-PAGE verified)

Amino Acid Sequence

The full-length sequence includes hydrophobic regions critical for membrane integration:
SPLDQFEMNTLLKFVTPFFDMSNLNITTFGLYIIIVLMVIVSLNILTTNNNTIIGSRWNL... (partial sequence; full sequence provided in ).

Functional Role in ATP Synthase

ATP6 is part of the F₀ proton channel, enabling:

  1. Proton translocation across the mitochondrial inner membrane.

  2. Energy coupling to ADP→ATP conversion in the F₁ catalytic domain .

In V. polyspora, ATP6 is regulated by PPR proteins (e.g., Atp22p), which stabilize its mRNA and facilitate translation . Mutations in ATP6 homologs (e.g., human MT-ATP6) are linked to mitochondrial disorders like Leigh syndrome .

Research Applications

ApplicationDetails
Structural StudiesX-ray crystallography, cryo-EM to map F₀ subunit interactions .
Enzyme Activity AssaysProton translocation and ATP synthesis efficiency in reconstituted systems.
Mitochondrial Disease ModelsStudy ATP6 mutations in V. polyspora to mimic human mitochondrial dysfunction .
Protein Interaction StudiesIdentify binding partners (e.g., ATP8, ATP9 subunits) .

Production and Quality Control

ParameterSpecification
Expression SystemE. coli under optimized conditions for solubility.
PurificationHis-tag affinity chromatography followed by size-exclusion chromatography.
Storage BufferTris/PBS, 6% trehalose, 50% glycerol, pH 8.0 .
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles .
HandlingAliquot into working solutions (0.1–1.0 mg/mL) and store at 4°C for ≤1 week.

Comparative Analysis with Human ATP6

FeatureV. polyspora ATP6Human MT-ATP6
Gene Length681 bp (partial overlap with ATP8) .681 bp (no overlap in humans).
Protein Weight~24.8 kDa~24.8 kDa
Evolutionary RateHigher substitution rates in mitochondrial isoforms .Lower substitution rates in humans.
Disease AssociationModel for mitochondrial dysfunction studies.Mutations linked to Leigh syndrome .

Key Research Findings

  1. Evolutionary Insights: V. polyspora ATP6 diverged from a dual-functional ancestor via whole-genome duplication, with mitochondrial isoforms evolving faster due to relaxed selection .

  2. PPR Protein Interactions: Atp22p stabilizes ATP6 mRNA and enhances translation efficiency in V. polyspora .

  3. Structural Adaptations: His-tagged ATP6 enables high-yield purification for biophysical studies .

References

  1. Creative BioMart. Recombinant Full Length Vanderwaltozyma Polyspora ATP Synthase Subunit A (ATP6) Protein, His-Tagged. RFL7117VF.

  2. MedlinePlus Genetics. MT-ATP6 Gene. MT-ATP6.

  3. Lipinski et al. Revisiting the Yeast PPR Proteins. PMC4456443.

  4. Wang et al. Divergent Alanyl-tRNA Synthetase Genes of Vanderwaltozyma polyspora. PMC1133750.

  5. MyBioSource. Recombinant Vanderwaltozyma polyspora ATP synthase subunit a (ATP6).522847.

  6. Wikipedia. MT-ATP6. MT-ATP6.

  7. PMC. Divergent Alanyl-tRNA Synthetase Genes. PMC4456443.

  8. GeneBioSystems. Recombinant Vanderwaltozyma polyspora ATP synthase subunit a. Product Page.

  9. PMC. Diminished Synthesis of Subunit a (ATP6). PMC1133750.

  10. Wikipedia. Vanderwaltozyma. Vanderwaltozyma.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; VapofMp08; ATP synthase subunit a; ATP synthase subunit 6; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
6-254
Protein Length
Full Length of Mature Protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
ATP6
Target Protein Sequence
SPLDQFEMNTLLKFVTPFFDMSNLNITTFGLYIIIVLMVIVSLNILTTNNNTIIGSRWNL PLEMIYDTILNTTKGQIGGKLWGLYFPLIYTLFMFILIANLISLIPYSFALTAQIVFVIS LSFIIWLGSTITGFNKHGWLFFSLFVPNGTPTPLVPLLVIIESLSYIARAFSLGLRLTCN ILAGHLLMVILGGLLLNFININKLTLILGIIPFAMILAILCLEFAIAMIQSYVFATLTAS YIKDSLYLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (ATP6) and what is its role in cellular bioenergetics?

ATP synthase subunit a (ATP6) is an essential component of the F₁F₀-ATP synthase complex, which catalyzes the synthesis of ATP from ADP and inorganic phosphate (Pi) as the final step of the oxidative phosphorylation pathway. The ATP synthase complex consists of 16 different subunits and is composed of a globular F₁ catalytic part connected by two stalks to the membrane-embedded F₀ moiety that translocates protons across the mitochondrial inner membrane . Subunit a is one of only two F₀ subunits encoded by mitochondrial DNA (mtDNA), the other being A6L (ATP8) .

The specific function of subunit a is to form part of the proton channel along with multiple copies of subunit c. This channel is crucial for the rotary mechanism of ATP synthesis, as it converts the proton motive force across the inner mitochondrial membrane into mechanical energy that drives ATP production . Mutations in the ATP6 gene can disturb the function of this proton channel, often leading to severe mitochondrial encephalopathies .

What evolutionary insights can be gained from studying V. polyspora ATP6?

Studying V. polyspora ATP6 offers valuable evolutionary insights into mitochondrial gene conservation and adaptation. V. polyspora represents an interesting model organism as it underwent whole-genome duplication (WGD), leading to divergent evolution of some gene pairs . While the search results don't specifically mention ATP6 gene duplication in V. polyspora, the evolutionary patterns observed in its other mitochondrially-related genes like AlaRS could provide comparative frameworks.

The study of ATP6 in V. polyspora could reveal how critical mitochondrial components evolve under different selection pressures, particularly in organisms that have undergone genome duplication events. Such research might illuminate the balance between conservation of essential function and adaptation to specific environmental niches or metabolic requirements.

What are the recommended methods for cloning and expressing recombinant V. polyspora ATP6?

Cloning and expressing V. polyspora ATP6 requires careful consideration of its mitochondrial origin and membrane protein nature. Based on approaches used for similar V. polyspora genes, the following methodology is recommended:

  • Gene Amplification:

    • Design gene-specific primers with appropriate restriction sites (e.g., EagI for forward primer and XhoI for reverse primer)

    • The forward primer should be located approximately 300 bp upstream of the first ATG codon

    • The reverse primer should be positioned immediately upstream of the stop codon

    • Use high-fidelity polymerase for PCR amplification using genomic DNA as template

  • Vector Selection and Preparation:

    • Select a vector suitable for yeast expression, such as pRS315-His₆ (a low-copy-number yeast shuttle vector with a LEU2 marker)

    • Include a His₆ tag for purification and detection purposes

    • Ensure the construct will be expressed under control of the native promoter for physiological expression levels

  • Transformation and Expression:

    • Transform the construct into an appropriate host (S. cerevisiae can be used as a heterologous expression system)

    • For optimal expression of membrane proteins, consider specialized yeast strains designed for membrane protein production

This approach enables expression of the recombinant protein while maintaining its native regulatory elements, which is crucial for functional studies .

How can researchers effectively purify and stabilize recombinant V. polyspora ATP6 for structural and functional studies?

Purification and stabilization of recombinant V. polyspora ATP6 presents challenges due to its hydrophobic nature as a membrane protein. The following protocol is recommended:

  • Storage and Handling of Expressed Protein:

    • Store the purified protein in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, maintain at -80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Membrane Protein Extraction:

    • Disrupt cells using methods that preserve membrane protein integrity (e.g., glass bead homogenization or enzymatic spheroplasting)

    • Use gentle detergents like digitonin (0.1 mg detergent/mg protein) for initial solubilization

    • For complete solubilization, consider stronger detergents such as DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol)

  • Purification Strategy:

    • Utilize affinity chromatography via the His₆ tag

    • Implement size exclusion chromatography to separate the ATP synthase complex or subunit a from other membrane proteins

    • Consider blue native electrophoresis (BN-PAGE) for assessing the integrity of protein complexes

  • Stabilization Approaches:

    • Maintain critical lipids from the native environment

    • Consider nanodiscs or amphipols for long-term stability

    • Use glycerol (10-15%) in storage buffers to prevent aggregation

These methods help maintain the structural integrity and functional activity of the recombinant protein for downstream applications.

What analytical techniques are most effective for assessing the functional integrity of recombinant V. polyspora ATP6?

Multiple complementary analytical techniques should be employed to thoroughly assess the functional integrity of recombinant V. polyspora ATP6:

  • ATP Hydrolysis Assays:

    • Measure ATPase activity using a coupled enzyme assay that monitors NADH oxidation

    • Conduct assays in buffer containing 40 mM Tris-HCl (pH 7.4), 5 mM MgCl₂, 10 mM KCl, 2 mM phosphoenolpyruvate, 0.2 mM NADH, with pyruvate kinase and lactate dehydrogenase

    • Initiate reaction with 1 mM ATP and monitor the decrease in absorbance at 340 nm

    • Include control measurements with 2 μM aurovertin to assess specific inhibition

  • Proton Translocation Measurements:

    • Assess proton pumping activity using pH-sensitive fluorescent dyes or electrodes

    • Reconstitute the protein into liposomes for these functional assays

  • Structural Analysis:

    • Employ Blue-Native PAGE and two-dimensional electrophoresis to analyze complex assembly

    • Use Western blotting with antibodies against various subunits of the ATP synthase complex

    • Consider comparative analysis with antibodies against ATP6 (1:500 dilution) and other F₀ subunits

  • Respiration Measurements:

    • Monitor oxygen consumption in permeabilized cells using high-resolution respirometry

    • Assess ADP-stimulated respiration and ADP-induced decrease in mitochondrial membrane potential

Analytical TechniquePurposeKey Parameters
ATP Hydrolysis AssayMeasure catalytic activityAurovertin-sensitive activity, Km for ATP
Proton TranslocationAssess proton channel functionRate of proton movement, membrane potential
Blue-Native PAGEEvaluate complex assemblyComplex stability, subcomplex formation
Western BlottingDetect protein expressionExpression level, comparison with other subunits
RespirometryAssess integrated functionADP-stimulated respiration, coupling efficiency

These techniques provide complementary information about both the structural integrity and functional capacity of the recombinant protein.

How can site-directed mutagenesis of V. polyspora ATP6 be utilized to understand proton translocation mechanisms?

Site-directed mutagenesis of V. polyspora ATP6 represents a powerful approach to dissect the molecular mechanisms of proton translocation. Based on knowledge from studies of ATP6 mutations in other organisms, the following strategy is recommended:

  • Target Selection for Mutagenesis:

    • Focus on conserved residues in transmembrane regions that likely contribute to the proton channel

    • Consider targeting residues analogous to those implicated in human mitochondrial diseases (e.g., positions corresponding to human L156 which, when mutated to R or P, causes NARP or MILS)

    • Design mutations that alter charge, hydrophobicity, or hydrogen-bonding capacity

  • Functional Analysis of Mutants:

    • Evaluate ATP synthesis capacity of each mutant using luciferin/luciferase assays

    • Compare ATP hydrolysis rates to identify mutations that specifically affect synthesis without altering hydrolysis

    • Measure proton translocation efficiency using pH-sensitive probes

    • Assess structural integrity using BN-PAGE to identify mutations that compromise complex assembly versus those that specifically affect proton movement

  • Data Interpretation Framework:

    • Develop a structure-function map correlating specific amino acid positions with functional outcomes

    • Use molecular dynamics simulations to model the effects of mutations on proton path and protein dynamics

    • Compare findings with known disease-causing mutations in human ATP6 to establish evolutionary conservation of critical functional domains

What are the differences in ATP synthase assembly and function between V. polyspora and other yeast species?

Understanding the species-specific aspects of ATP synthase assembly and function requires comparative analysis between V. polyspora and other yeast species:

  • Assembly Pathway Analysis:

    • Compare the subunit composition and assembly intermediates using BN-PAGE and two-dimensional electrophoresis across species

    • Identify whether V. polyspora shows unique assembly factors or chaperones compared to S. cerevisiae

    • Assess the stability of assembled complexes under various detergent and salt conditions to determine species-specific structural robustness

  • Functional Comparison:

    • Measure ATP synthesis and hydrolysis rates under standardized conditions

    • Compare proton translocation efficiency across species

    • Assess sensitivity to specific inhibitors like oligomycin, aurovertin, and efrapeptin

    • Determine whether V. polyspora ATP synthase exhibits unique regulatory mechanisms

  • Evolutionary Adaptation Assessment:

    • Correlate functional differences with the ecological niche and metabolic requirements of V. polyspora

    • Consider whether genome duplication events in V. polyspora have influenced ATP synthase evolution through subfunctionalization or neofunctionalization

    • Examine whether patterns of asymmetric evolution seen in other V. polyspora genes (like AlaRS) extend to components of the ATP synthase complex

This comparative approach can reveal how evolutionary pressures have shaped species-specific adaptations in this fundamental bioenergetic complex.

What are common issues in expression and purification of recombinant V. polyspora ATP6, and how can they be addressed?

Researchers frequently encounter challenges when working with recombinant ATP6 due to its hydrophobic nature and mitochondrial origin. Here are common issues and their solutions:

  • Low Expression Levels:

    • Problem: ATP6 as a membrane protein often expresses poorly in heterologous systems.

    • Solutions:

      • Optimize codon usage for the expression host

      • Use stronger promoters while maintaining proper regulation

      • Consider fusion tags that can enhance folding and stability

      • Explore specialized yeast strains designed for membrane protein expression

  • Protein Misfolding and Aggregation:

    • Problem: Hydrophobic membrane proteins tend to aggregate during expression.

    • Solutions:

      • Lower the expression temperature (20-25°C)

      • Add specific lipids to the growth medium

      • Express as part of the entire ATP synthase complex rather than in isolation

      • Include chemical chaperones in the growth medium (e.g., glycerol, trimethylamine N-oxide)

  • Poor Solubilization:

    • Problem: Inefficient extraction from membranes.

    • Solutions:

      • Screen multiple detergents at various concentrations

      • Use gentler extraction methods with digitonin (0.1 mg/mg protein)

      • Consider new solubilization tools like SMALPs (styrene maleic acid lipid particles)

      • Adjust buffer conditions (pH, salt concentration) to optimize solubilization

  • Protein Instability During Storage:

    • Problem: Activity loss during storage.

    • Solutions:

      • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

      • Avoid repeated freeze-thaw cycles

      • Maintain working aliquots at 4°C for no more than one week

      • Consider lyophilization for long-term storage

These optimization strategies can significantly improve the yield and quality of recombinant V. polyspora ATP6 for research applications.

How can researchers troubleshoot inconsistent results in ATP6 functional assays?

Inconsistent results in functional assays can arise from multiple sources. The following troubleshooting guide addresses common issues:

  • Variable ATP Hydrolysis Activity:

    • Problem: Inconsistent readings in ATPase activity assays.

    • Troubleshooting:

      • Verify enzyme coupling system components (pyruvate kinase, lactate dehydrogenase) are fresh and active

      • Ensure consistent protein-to-detergent ratios across experiments

      • Control for contaminating ATPases using specific inhibitors (oligomycin for F-type ATPases, aurovertin at 2 μM)

      • Standardize protein quantification methods

      • Measure both in the presence and absence of inhibitors to determine specific activity

  • Poor Correlation Between ATP Synthesis and Hydrolysis:

    • Problem: ATP synthesis capacity doesn't correlate with hydrolysis rates.

    • Troubleshooting:

      • Ensure the integrity of the proton gradient in synthesis assays

      • Verify the orientation of the protein in reconstituted systems

      • Consider that certain mutations may specifically affect synthesis while preserving hydrolysis

      • Check for uncoupling between the F₁ and F₀ domains

  • Inconsistent Complex Assembly:

    • Problem: Variable patterns in BN-PAGE analysis.

    • Troubleshooting:

      • Standardize solubilization conditions

      • Control for sample oxidation by including reducing agents

      • Ensure consistent detergent-to-protein ratios

      • Compare patterns with known controls from other species or mutants

      • Consider that altered patterns may reflect physiologically relevant subcomplexes rather than experimental artifacts

  • Data Interpretation Framework:

    • Problem: Difficulty distinguishing experimental variation from biological significance.

    • Approach:

      • Establish clear positive and negative controls for each assay

      • Perform sufficient biological and technical replicates

      • Use statistical approaches appropriate for the data distribution

      • Consider integrating multiple assay types for a comprehensive assessment

This systematic troubleshooting approach can help identify sources of variability and improve data consistency and reliability.

What considerations are important when designing experiments to compare wild-type and mutant forms of V. polyspora ATP6?

Designing rigorous comparative experiments between wild-type and mutant ATP6 requires careful attention to multiple factors:

  • Experimental Design Principles:

    • Ensure isogenic backgrounds between wild-type and mutant strains

    • Control for expression levels by using the same promoter and vector system

    • Include positive and negative controls in each experiment

    • Perform experiments in a blinded fashion when possible

    • Design experiments with sufficient statistical power (minimum n=3 biological replicates)

  • Comprehensive Functional Assessment:

    • Evaluate multiple functional parameters:

      • ATP synthesis capacity

      • ATP hydrolysis activity with and without specific inhibitors (aurovertin)

      • Proton translocation efficiency

      • Complex assembly and stability via BN-PAGE

      • Respiratory capacity in cellular contexts

    • Compare results across assays to develop a complete functional profile

  • Controls and Validation:

    • Include established mutants with known phenotypes as reference points

    • Verify that observed defects are specifically due to the introduced mutation by:

      • Complementation studies with wild-type protein

      • Creating and testing revertant mutations

      • Assessing the effect of the mutation in different genetic backgrounds

  • Data Analysis Framework:

    • Use appropriate statistical tests for each data type

    • Consider developing a scoring system that integrates multiple parameters

    • Establish clear thresholds for defining functional defects

    • Create visualization tools that effectively communicate the multidimensional nature of the data

ParameterWild-Type MeasurementMutant MeasurementStatistical Analysis
ATP Synthesis RateX nmol/min/mgY nmol/min/mgt-test or ANOVA
ATP HydrolysisZ nmol/min/mgW nmol/min/mgt-test or ANOVA
Aurovertin Sensitivity% inhibition% inhibitiont-test
Complex AssemblyBN-PAGE patternBN-PAGE patternQualitative comparison
Respiratory RateO₂ consumptionO₂ consumptiont-test or ANOVA

This comprehensive approach ensures that comparisons between wild-type and mutant forms yield reliable, interpretable data that can advance understanding of structure-function relationships in ATP6.

How might cryo-EM approaches advance our understanding of V. polyspora ATP synthase structure and function?

Cryo-electron microscopy (cryo-EM) represents a revolutionary approach for studying membrane protein complexes like ATP synthase. For V. polyspora ATP synthase research, cryo-EM offers several advantages:

Cryo-EM approaches have the potential to provide unprecedented insights into the molecular mechanisms of ATP synthase function and the specific role of ATP6 in this essential bioenergetic complex.

What omics approaches could provide insights into the regulatory networks involving V. polyspora ATP6?

Integrative omics approaches can reveal the broader biological context of ATP6 function in V. polyspora:

These omics approaches can provide a systems-level understanding of ATP6 function and regulation in the broader context of cellular metabolism and adaptation.

How might synthetic biology approaches utilizing V. polyspora ATP6 contribute to bioenergetic engineering?

Synthetic biology approaches utilizing V. polyspora ATP6 offer exciting possibilities for bioenergetic engineering:

  • ATP Synthase Optimization:

    • Engineer ATP6 variants with enhanced coupling efficiency

    • Design ATP synthase complexes with altered ion specificity (H⁺ vs. Na⁺)

    • Create chimeric ATP synthases combining features from different species for optimal performance

    • Develop ATP synthases with resistance to inhibitors or environmental stressors

  • Biotechnological Applications:

    • Creation of yeast strains with enhanced ATP production for industrial fermentations

    • Development of biosensors based on ATP synthase function for monitoring cellular energetics

    • Engineering of artificial organelles with custom-designed ATP synthases

    • Integration of engineered ATP synthases into biohybrid systems for energy conversion

  • Methodological Approaches:

    • Directed evolution of ATP6 for specific functional properties

    • Rational design based on structural information and computational modeling

    • Development of high-throughput screening systems for ATP synthase function

    • Creation of minimal ATP synthase systems with reduced complexity

  • Potential Impact Areas:

    • Biofuel production optimization

    • Enhancement of industrial fermentation processes

    • Development of new approaches for treating mitochondrial diseases

    • Creation of bio-inspired energy conversion systems

Synthetic biology approaches using V. polyspora ATP6 could lead to both fundamental insights into bioenergetic principles and practical applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.