Recombinant Vanderwaltozyma polyspora Autophagy-related protein 33 (ATG33)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Vanderwaltozyma polyspora Autophagy-related protein 33 (ATG33) is a recombinant protein derived from the yeast Vanderwaltozyma polyspora (formerly Kluyveromyces polysporus). It belongs to the autophagy machinery, a conserved cellular pathway responsible for degrading damaged organelles and recycling macromolecules. ATG33 is homologous to proteins involved in selective autophagy, such as mitophagy (mitochondria degradation) and pexophagy (peroxisome degradation) in other yeast models .

Mitophagy and Organelle Degradation

In Saccharomyces cerevisiae, ATG33 is localized to the mitochondrial outer membrane and facilitates mitophagy under starvation or stationary-phase conditions. Deletion of ATG33 reduces mitophagy efficiency, particularly during cell aging . Homologous mechanisms may exist in Vanderwaltozyma, though functional confirmation is pending.

Interactions with Autophagy Machinery

ATG33 may interact with core autophagy components (e.g., Atg8, Atg11) to tag organelles for degradation. In S. cerevisiae, analogous receptors like Atg36 bind Atg8 and Atg11 to link peroxisomes to autophagosomes . Similar motifs in ATG33 could enable analogous interactions.

Production and Purity

  • Expression System: Recombinant ATG33 is produced in E. coli, leveraging its robust protein production capabilities .

  • Purification: His-tag affinity chromatography ensures high purity (>90%) .

  • Stability: Lyophilized powder stored at -20°C/-80°C; repeated freeze-thaw cycles are discouraged .

Potential Uses in Research

  • Studying Autophagy Receptors: ATG33 could serve as a model to investigate receptor-mediated autophagy in non-model yeast species.

  • Structural Studies: The protein’s crystallization potential (as seen in related RNase III proteins ) may aid in elucidating autophagy receptor mechanisms.

  • Cross-Species Comparisons: Comparative analysis with S. cerevisiae ATG33 or Pichia pastoris Atg30 could reveal evolutionary divergence in autophagy pathways .

Gene Information

AttributeDetails
Gene NameATG33 (synonyms: Kpol_543p32)
UniProt IDA7THN6
SpeciesVanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294)

Taxonomic Background

Vanderwaltozyma polyspora is a rarely isolated yeast species characterized by oblong ascospores and multiporous asci . Its genome retains divergent gene paralogs, such as alanyl-tRNA synthetase isoforms, arising from whole-genome duplication events . This genomic context may influence ATG33’s evolutionary role.

Future Directions

  • Functional Characterization: Biochemical assays to confirm ATG33’s interaction with autophagy components (e.g., Atg8, Atg11).

  • Phylogenetic Analysis: Comparison with S. cerevisiae ATG33 and P. pastoris Atg30 to map conserved domains.

  • Therapeutic Applications: Exploring ATG33’s role in organelle quality control for biotechnological or medical research.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
ATG33; Kpol_543p32; Autophagy-related protein 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
ATG33
Target Protein Sequence
MSVCLGVTKTIAVSSLGLYAGLLTTTTLVTASAPIDLLLPRTNENPIVNYFKSIVCSVGK ISTVLSGLSTIFFGASYFGSPLSLRHPYLIYGMVIAPISAAYLYGASLFAHRHPSADQEK NNSPSPALDDSTVDLGKDFKHPKITPGEAGKCPFGSKTSIEASSESSRKNCNASIVAHLS VVTVFTILGFVQSVVGLYGEGHFV
Uniprot No.

Target Background

Function
ATG33 plays a crucial role in the selective degradation of mitochondria through autophagy. This process occurs during starvation and at the post-log phase.
Database Links
Protein Families
ATG33 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Vanderwaltozyma polyspora and why is it significant for autophagy research?

Vanderwaltozyma polyspora is a yeast species that descended from the same whole-genome duplication event as Saccharomyces cerevisiae. It has gained significance in molecular biology research due to its unique gene organization patterns. Unlike other yeast species, V. polyspora possesses distinct nuclear genes encoding separate proteins for different cellular compartments, as evidenced by its dual alanyl-tRNA synthetase genes - one for cytoplasmic function and another for mitochondrial function . This compartmentalized gene structure makes V. polyspora an excellent model for studying protein targeting and function in different cellular locations, including autophagy-related processes.

The significance of V. polyspora in autophagy research stems from its potential to reveal evolutionary patterns in autophagy machinery. Studying autophagy-related proteins like ATG33 in this organism could provide insights into how selective autophagy mechanisms diverged following whole-genome duplication events, particularly for mitochondrial quality control pathways.

How do autophagy-related proteins typically function in yeast mitochondrial maintenance?

Autophagy-related proteins in yeast play crucial roles in mitochondrial quality and quantity control through mitophagy, the selective degradation of mitochondria via autophagic mechanisms. These proteins typically function through several key mechanisms:

  • Recognition of damaged or excess mitochondria for selective degradation

  • Tethering of isolation membranes to mitochondria

  • Promotion of autophagosome formation around targeted mitochondria

  • Facilitation of autophagosome-vacuole fusion for cargo degradation

For instance, in Schizosaccharomyces pombe, Atg43 acts as a mitophagy receptor by localizing to the mitochondrial outer membrane and containing an Atg8-family-interacting motif (AIM/LIR) essential for mitophagy . The protein tethers expanding isolation membranes to mitochondria, promoting their selective degradation. Similar mechanisms likely exist for autophagy-related proteins in V. polyspora, though specific functional characterization of ATG33 would require experimental validation.

What is the relationship between TORC1 signaling and autophagy-related protein expression?

Target of rapamycin complex 1 (TORC1) signaling serves as a master regulator of autophagy in yeast species. Under nutrient-rich conditions, TORC1 suppresses autophagy by phosphorylating core autophagy proteins . Research with temperature-sensitive mutants of the Tor2 kinase subunit of TORC1 (tor2-13) has demonstrated that inactivation of TORC1 results in increased expression of autophagy-related proteins and induction of mitophagy .

What techniques are most effective for determining subcellular localization of autophagy-related proteins in yeast?

Multiple complementary approaches should be employed to definitively establish the subcellular localization of autophagy-related proteins like ATG33:

Fluorescence Microscopy with Tagged Proteins:

  • Express GFP-tagged or other fluorescently tagged versions of the protein of interest

  • Co-localize with established compartment markers (e.g., Tuf1-mRFP for mitochondria)

  • Validate localization under both normal and autophagy-inducing conditions

Subcellular Fractionation:

  • Prepare cell homogenates and separate fractions via differential centrifugation

  • Confirm presence of the protein in the mitochondria-enriched fraction using immunoblotting

  • Compare distribution with known markers of different cellular compartments

Protease Protection Assays:

  • Treat isolated mitochondria with proteinase K under different conditions:

    • Without treatment (control)

    • With hypo-osmotic swelling (to disrupt outer membrane)

    • With detergent (to disrupt all membranes)

  • Analyze protection patterns to determine topology (e.g., mitochondrial outer membrane proteins are digested without swelling or lysis)

Alkaline Extraction:

  • Treat mitochondria with sodium carbonate at high pH

  • Centrifuge to separate peripheral (supernatant) from integral (pellet) membrane proteins

  • Use immunoblotting to determine if the protein behaves as an integral or peripheral membrane protein

Using these approaches, researchers studying autophagy-related proteins like ATG33 can determine both localization and membrane topology with high confidence.

How can researchers reliably measure mitophagy and distinguish it from general autophagy in yeast models?

Distinguishing mitophagy from general autophagy requires specific assays focused on mitochondrial degradation:

GFP Processing Assay with Mitochondrial Markers:

  • Express mitochondrial proteins tagged with fluorescent proteins (e.g., Tuf1-mRFP, GFP-tagged Sdh2)

  • Monitor processing of the tag during autophagy via immunoblotting

  • The appearance of free fluorescent protein band indicates degradation of the mitochondrial marker

Mitochondrial Marker Degradation Assay:

  • Express mitochondrial markers from different compartments (matrix, inner membrane, and outer membrane)

  • Monitor protein levels during starvation conditions

  • Compare degradation patterns with autophagy-deficient strains as controls

Fluorescence Microscopy for Vacuolar Delivery:

  • Visualize delivery of mitochondrially-targeted fluorescent proteins to the vacuole

  • Co-localize with vacuolar markers during starvation conditions

  • Quantify the percentage of cells showing vacuolar localization of mitochondrial markers

Controls for Specificity:

  • Include general autophagy markers to distinguish selective from non-selective processes

  • Compare with known autophagy-deficient (atg7Δ) and mitophagy-specific mutants

  • Test under conditions that specifically induce mitophagy (e.g., respiratory growth followed by nitrogen starvation)

These methodologies provide comprehensive assessment of mitophagy and help differentiate it from general autophagy processes when studying proteins like ATG33.

What approaches are most effective for studying protein-protein interactions involving autophagy-related proteins?

Several complementary methods should be employed to establish protein-protein interactions involving autophagy-related proteins:

Yeast Two-Hybrid Assay:

  • Test direct interactions between the cytosolic domains of autophagy-related proteins and known autophagy machinery components

  • Create truncated constructs to map interaction domains

  • Verify with mutated versions of identified interaction motifs (e.g., AIM/LIR sequences)

Co-Immunoprecipitation:

  • Express tagged versions of the proteins of interest

  • Immunoprecipitate with antibodies against the tag

  • Analyze co-precipitated proteins by immunoblotting

  • Include negative controls (e.g., mutated interaction motifs) to confirm specificity

Bimolecular Fluorescence Complementation:

  • Fuse complementary fragments of a fluorescent protein to potential interaction partners

  • Reconstitution of fluorescence indicates proximity of proteins in living cells

  • This approach allows visualization of interactions in their native subcellular context

Proximity-Dependent Labeling:

  • Fuse the protein of interest to enzymes like BioID or APEX2

  • Identify proteins in proximity through biotinylation followed by streptavidin pulldown and mass spectrometry

  • This method can identify transient or weak interactions

For researchers studying ATG33, applying these methodologies would help identify key binding partners and elucidate its role in autophagy/mitophagy pathways.

How do non-canonical translation initiation mechanisms affect mitochondrial protein targeting in yeast?

Non-canonical translation initiation plays a significant role in protein targeting, especially for mitochondrial proteins. In V. polyspora, the mitochondrial form of alanyl-tRNA synthetase (AlaRS) is initiated from upstream non-AUG codons despite the presence of a promising AUG initiator candidate . Specifically:

  • Non-AUG initiation sites (e.g., ACG, TTG) can serve as the major initiation sites for mitochondrial proteins

  • These alternative start sites often enable the translation of N-terminal mitochondrial targeting signals

  • Multiple non-AUG sites may function redundantly, with one serving as the major initiation site and others as minor sites

In the case of V. polyspora ALA2, ACG(-23) serves as the major initiation site while TTG(-28) functions as a minor initiation site . This non-canonical initiation is crucial for producing the mitochondrial targeting signal that directs the protein to mitochondria.

For researchers studying ATG33, evaluating potential non-AUG initiation sites would be essential, particularly if:

  • The protein contains a mitochondrial targeting sequence

  • The predicted protein from AUG initiation lacks targeting signals

  • The protein shows dual localization patterns

Methodologically, this would involve mutational analysis of candidate non-AUG codons coupled with functional complementation assays and localization studies .

What mechanisms regulate the expression and activity of mitophagy receptors during different cellular stress conditions?

Mitophagy receptors undergo complex regulation during cellular stress, as evidenced by studies of Atg43 in S. pombe:

Transcriptional Regulation:

  • Under nitrogen starvation, expression levels of mitophagy receptors increase significantly

  • This upregulation is controlled by TORC1 signaling pathways, as demonstrated with temperature-sensitive tor2-13 mutants

  • Quantitative RT-PCR can assess transcriptional changes under different stress conditions

Post-translational Regulation:

  • Mitophagy receptors themselves are degraded through autophagy, creating a feedback mechanism

  • This can be monitored through GFP processing assays showing accumulation in autophagy-defective strains

  • Protein stability and turnover rates vary under different stress conditions

Functional Domain Regulation:

  • Distinct functional domains mediate different aspects of receptor activity

  • For example, in Atg43, aa 21-40 containing an AIM/LIR motif is necessary for mitophagy but dispensable for mitochondrial localization

  • The C-terminal region often contains transmembrane domains essential for mitochondrial targeting

For researchers studying ATG33, analyzing its expression patterns, degradation kinetics, and domain-specific functions under various stress conditions would provide insights into its regulatory mechanisms.

How do autophagy-related proteins contribute to mitochondrial quality control beyond canonical mitophagy?

Autophagy-related proteins often have dual roles in cellular homeostasis beyond their canonical functions in autophagic degradation:

Growth Maintenance Functions:

  • Some autophagy-related proteins support cellular growth independent of their role in mitophagy

  • For instance, Atg43-deficient cells exhibit growth defects not observed in general autophagy-defective mutants

  • These growth-related functions may involve specific protein domains distinct from those required for mitophagy

Mitochondrial Function Regulation:

  • Autophagy-related proteins may influence mitochondrial membrane potential and respiratory activity

  • Cells lacking mitophagy capabilities can show altered reactive oxygen species production during nitrogen starvation

  • These functions might involve direct interactions with respiratory chain components or regulatory factors

Mitochondrial Import Factor Interactions:

  • Mitochondrial import factors, including the Mim1-Mim2 complex and Tom70, can be crucial for mitophagy

  • These factors may contribute to mitophagy through proper localization of mitophagy receptors

  • Understanding these interactions provides insights into the dual role of mitochondrial import machinery

For ATG33 research, investigating phenotypes beyond mitophagy defects (such as growth, respiration, or membrane potential) would help elucidate its full functional spectrum in cellular homeostasis.

What controls are essential when analyzing the subcellular distribution of recombinant autophagy-related proteins?

When analyzing subcellular distribution of recombinant autophagy-related proteins like ATG33, the following controls are essential:

Expression Level Controls:

  • Compare expression levels between endogenous and recombinant proteins

  • Use promoters that provide physiologically relevant expression levels

  • Avoid overexpression artifacts that can cause mislocalization

Compartment Marker Controls:

  • Include well-established markers for relevant compartments:

    • Mitochondrial matrix (e.g., Tuf1-mRFP)

    • Mitochondrial outer membrane (e.g., Tom70)

    • Mitochondrial inner membrane (e.g., Mic60)

  • These markers confirm proper fractionation and visualization of cellular compartments

Functional Complementation Controls:

  • Verify that tagged/recombinant proteins retain functionality

  • Rescue experiments in knockout strains should restore wild-type phenotypes

  • If the protein is essential for mitophagy, mitophagy assays should show restoration

Treatment Condition Controls:

  • Compare localization under both normal and autophagy-inducing conditions

  • Include appropriate time points to capture dynamic localization changes

  • Use inhibitors (e.g., TORC1 inhibitors) to validate pathway-specific responses

These controls ensure reliable interpretation of localization data and minimize artifacts when working with recombinant autophagy-related proteins.

How should researchers interpret conflicting data on autophagy-related protein function between different yeast species?

When faced with conflicting data on autophagy-related protein function between yeast species, researchers should consider:

Evolutionary Context:

  • Whole-genome duplication events can lead to subfunctionalization of duplicated genes

  • V. polyspora descended from the same whole-genome duplication event as S. cerevisiae but may have evolved different functional specializations

  • Phylogenetic analysis can provide context for functional divergence

Methodological Differences:

  • Establish a standardized framework for comparing results across species

  • Ensure experimental conditions (media, growth phase, induction methods) are as comparable as possible

  • When appropriate, perform parallel experiments in multiple species using identical protocols

Protein Domain Conservation:

  • Analyze conservation of key functional domains (e.g., AIM/LIR motifs, transmembrane domains)

  • Functionally test conserved domains through complementation studies across species

  • Domain swapping experiments can identify species-specific functional elements

Data Integration Table:

FeatureSpecies ASpecies BPossible Explanation for Differences
LocalizationMitochondrialCytosolicDifferent targeting signals or import machinery
Expression patternConstitutiveStress-inducedDifferent regulatory elements in promoters
Binding partnersAtg8 interactionNo Atg8 interactionPresence/absence of AIM/LIR motifs
Phenotype of knockoutLethalViableFunctional redundancy in one species but not the other

This systematic approach helps researchers reconcile apparently conflicting data and better understand the evolutionary context of autophagy-related protein function.

What statistical approaches are most appropriate for quantifying mitophagy in yeast experimental systems?

Quantitative analysis of mitophagy requires robust statistical approaches tailored to the specific assay:

For Biochemical Assays (e.g., GFP Processing):

  • Measure band intensities using densitometry

  • Calculate the ratio of free GFP to total GFP-fusion protein

  • Apply repeated measures ANOVA to compare conditions across multiple time points

  • Present data as mean ± standard deviation with appropriate significance indicators

For Microscopy-Based Quantification:

  • Count cells showing vacuolar accumulation of mitochondrial markers

  • Calculate percentage of cells with mitophagy among total population

  • Use chi-square tests for comparing proportions between conditions

  • Include at least 100-200 cells per condition for statistical power

For Growth and Viability Measurements:

Experimental Design Considerations:

  • Include at least three biological replicates for all experiments

  • Perform power analysis to determine appropriate sample sizes

  • Use appropriate multiple comparison corrections when testing numerous conditions

  • Include both positive controls (known mitophagy inducers) and negative controls (atg deletion strains)

These statistical approaches ensure robust quantification and comparison of mitophagy across different experimental conditions when studying proteins like ATG33.

How can researchers distinguish between direct and indirect effects of ATG33 on mitophagy?

Distinguishing direct from indirect effects requires multiple approaches:

Targeted Mutagenesis:

  • Generate point mutations in specific functional domains (e.g., AIM/LIR motifs)

  • If mutation of a specific domain abolishes mitophagy without affecting localization, this suggests a direct role

  • Compare with complete deletion phenotypes to identify domain-specific functions

Artificial Tethering Experiments:

  • Force recruitment of core autophagy machinery (e.g., Atg8) to mitochondria in ATG33-deficient cells

  • If this bypasses the requirement for ATG33, it suggests ATG33 primarily functions in tethering isolation membranes to mitochondria

  • This approach has successfully demonstrated the tethering function of other mitophagy receptors

Temporal Analysis:

  • Use time-course experiments with synchronized cells to establish the sequence of events

  • Direct effects typically manifest immediately after protein activation/induction

  • Indirect effects often show delayed kinetics dependent on intermediate steps

Bypass Experiments:

  • Test whether artificial mitochondrial loading of ATG33 can bypass the requirement for mitochondrial import factors

  • Similar approaches with Atg43 demonstrated that import factors contribute to mitophagy through proper receptor localization

These methodologies provide complementary evidence to distinguish direct mitophagy effects from indirect consequences of ATG33 function.

What experimental approaches best reveal the physiological significance of mitophagy in yeast lifespan and stress resistance?

To assess the physiological significance of mitophagy mediated by proteins like ATG33:

Chronological Lifespan Analysis:

  • Measure survival of non-dividing cells over time in stationary phase

  • Compare wild-type, ATG33-deficient, and general autophagy-deficient strains

  • Assess the impact of different nutrient conditions on lifespan differences

Stress Resistance Assays:

  • Challenge cells with various stressors:

    • Oxidative stress (H₂O₂, menadione)

    • Mitochondrial stress (electron transport chain inhibitors)

    • Nutrient limitation (carbon or nitrogen starvation)

  • Measure survival, growth inhibition, and recovery rates

  • Test whether ATG33 overexpression enhances resistance to specific stressors

Mitochondrial Function Assessment:

  • Measure parameters including:

    • Oxygen consumption rates

    • Membrane potential (using potentiometric dyes)

    • ROS production (using fluorescent indicators)

    • ATP production

  • Compare these parameters under normal and stress conditions

  • Assess whether mitophagy defects lead to accumulation of dysfunctional mitochondria

Gene Expression Analysis:

  • Perform transcriptomic analysis of wild-type and ATG33-deficient strains

  • Identify compensatory pathways activated in the absence of proper mitophagy

  • Look for signatures of mitochondrial dysfunction and stress response activation

These approaches collectively reveal how mitophagy contributes to cellular homeostasis, stress resistance, and longevity in yeast systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.