Recombinant Vanderwaltozyma polyspora Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
COX2; VapofMp05; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
COX2
Target Protein Sequence
MYILTNILSIISNDVPTPYALGFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIT KTYSKNPLPYKYMKHGQFIEIIWTIFPAVVLLIIAFPSFILLYLCDEVISPAMTVKVIGY QWYWKYEYSDFVNSNGETVEFESYIIPDDLLEEGQLRLLDTDTSVVVPVDTHIRFIVTAA DVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGMCSELCGTGHSQMPIKIEVVSLG KYLGWLNEQ
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthase activity. COX2 plays a crucial role in the cytochrome c oxidase complex, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and Cu(B). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Vanderwaltozyma polyspora Cytochrome c oxidase subunit 2 (COX2)?

Vanderwaltozyma polyspora Cytochrome c oxidase subunit 2 (COX2) is a mitochondrially-encoded protein component of Complex IV (cytochrome c oxidase) in the electron transport chain. The full-length protein consists of 249 amino acids and plays a critical role in cellular respiration. COX2 contains the initial electron acceptor site in the cytochrome c oxidase complex, making it essential for the transfer of electrons from cytochrome c to the catalytic center of the enzyme .

The protein structure includes transmembrane domains that anchor it in the inner mitochondrial membrane, and functional regions responsible for interaction with cytochrome c and other subunits of the complex. In Vanderwaltozyma polyspora, COX2 is part of a highly conserved mitochondrial respiratory system that has been used in evolutionary and comparative studies across fungal species .

How does COX2 function in the mitochondrial respiratory chain?

COX2 functions as a critical component of cytochrome c oxidase (Complex IV), the terminal enzyme of the mitochondrial respiratory chain. Its primary role involves:

  • Initial electron acceptance: COX2 contains the binding site for cytochrome c and is directly responsible for the initial transfer of electrons from cytochrome c to the cytochrome c oxidase complex .

  • Electron transport: These electrons are subsequently transferred through the complex to molecular oxygen, which is reduced to water, completing the respiratory chain.

  • Energy conservation: This electron transfer process contributes to proton pumping across the inner mitochondrial membrane, generating the electrochemical gradient necessary for ATP synthesis.

The functional importance of COX2 is evident from evolutionary studies showing that while it displays significant sequence variation between species, functionally critical amino acids remain highly conserved . The protein's structure includes metal-binding sites (particularly copper centers) that are essential for its electron transfer capabilities.

What expression systems are most effective for recombinant Vanderwaltozyma polyspora COX2 production?

Multiple expression systems have been employed for the production of recombinant COX2 proteins, each with distinct advantages:

The choice of expression system should be guided by experimental requirements for protein folding, post-translational modifications, and the intended downstream applications.

What are the optimal purification protocols for obtaining active recombinant COX2?

A systematic purification strategy for recombinant COX2 typically involves these key steps:

  • Cell lysis and membrane protein extraction: Using appropriate detergents to solubilize the membrane-bound COX2 protein. The choice of detergent is critical, as demonstrated in studies of cytochrome c oxidase solubilization .

  • Affinity chromatography: For His-tagged V. polyspora COX2, immobilized metal affinity chromatography (IMAC) provides an efficient initial purification step.

  • Ion-exchange chromatography: Further purification using anion or cation exchange, depending on the protein's isoelectric point. Research on human COX proteins has demonstrated the effectiveness of this approach .

  • Size exclusion chromatography: A final polishing step to achieve high purity and remove aggregates.

  • Buffer optimization: Recombinant V. polyspora COX2 is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How can researchers assess the activity and integrity of purified recombinant COX2?

Multiple assays can be employed to verify the functionality and structural integrity of purified recombinant COX2:

  • Enzymatic activity assay: For recombinant human COX-2, a fluorescence-based assay using Arachidonic acid and Amplex Ultra Red (AUR) has been established with the following protocol :

    ComponentConcentration
    rhCOX-20.25 µg
    Arachidonic acid25 µM
    AUR50 µM

    The specific activity is calculated as:

    Specific Activity (pmol/min/µg) = [Adjusted Fluorescence (RFU) × Conversion Factor (pmol/RFU)] / [Incubation time (min) × amount of enzyme (µg)]

  • Oxidase activity test: This test detects the presence of a cytochrome oxidase system using redox dyes such as tetramethyl-p-phenylene-diamine, which turn purple when oxidized .

  • Spectroscopic analysis: Absorption spectroscopy can verify the incorporation of heme groups critical for COX2 function.

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy and thermal shift assays can confirm proper protein folding.

  • Interaction studies: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can verify binding to cytochrome c or other interaction partners.

How does V. polyspora COX2 compare to COX2 proteins from other species?

Comparative analysis of COX2 across species reveals both conserved features and significant variations:

  • Sequence conservation and divergence: While the core functional regions of COX2 are generally conserved across species, significant sequence divergence exists. Studies in Tigriopus californicus showed interpopulation divergence at the COX2 locus of nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions .

  • Evolutionary rate variation: In primates, monkeys and apes have undergone a nearly two-fold increase in the rate of amino acid replacement in COX2 relative to other primates, with increased variation particularly evident in the amino terminal region .

  • Functional adaptations: The replacement of specific amino acids can significantly impact function. For example, the replacement of two carboxyl-bearing residues (glutamate and aspartate) at positions 114 and 115 in higher primates may explain poor enzyme kinetics in cross-reactions between cytochromes c and cytochrome c oxidases of higher primates and other mammals .

  • Structural organization: While the Vanderwaltozyma polyspora COX2 shares the fundamental structure of other COX2 proteins, species-specific variations in transmembrane domains, metal-binding sites, and interaction surfaces likely exist and may reflect adaptations to specific environmental conditions or metabolic requirements.

This comparative perspective is valuable for understanding the evolutionary constraints and adaptations of this critical respiratory protein.

What role does COX2 play in mitochondrial genome evolution?

COX2 has significant implications for understanding mitochondrial genome evolution:

  • Conserved gene with variable positioning: COX2 is one of the conserved genes in mitochondrial genomes across fungi and other eukaryotes, but its positioning in the genome varies considerably between species .

  • Leader peptide and translation regulation: In yeast species, the COX2 gene encodes a precursor protein with a leader peptide. Studies in Saccharomyces cerevisiae have shown that the mRNA sequence encoding this leader peptide plays a crucial role in controlling translation, while the amino acid sequence of the leader peptide itself has fewer constraints .

  • Intron dynamics: In some yeast species, COX2 can acquire extensions derived from intronic elements. The study of mitochondrial introns across Saccharomycotina revealed clusters of related introns that span multiple taxonomic groups, suggesting horizontal gene transfer events involving these mobile genetic elements .

  • Translation regulation mechanisms: The expression of COX2 in yeast involves specific translation activators like Pet111p, which interact with the COX2 mRNA 5'-UTL and promote translation through a conserved mechanism .

  • Gene order rearrangements: The patterns of COX2 and other mitochondrial gene rearrangements in fungi may be explained by recombination, accumulated repeats, and mobile element dynamics, contributing to the remarkable variation observed between and within major fungal phyla .

These characteristics make COX2 a valuable marker for studying the evolution of mitochondrial genomes and the mechanisms that drive their diversification.

How can recombinant COX2 be used in structural and functional studies?

Recombinant COX2 provides a powerful tool for diverse research applications:

  • Structural studies: Purified recombinant COX2 can be used in X-ray crystallography or cryo-electron microscopy to determine atomic resolution structures. Human recombinant COX-2 prepared through similar methods has been successfully used in crystallography studies .

  • Protein-protein interaction studies: Recombinant COX2 can be employed to investigate interactions with:

    • Cytochrome c, its electron donor

    • Other subunits of the cytochrome c oxidase complex

    • Assembly factors and chaperones involved in complex formation

  • Enzyme kinetics: Using purified recombinant COX2 in reconstituted systems allows for detailed study of electron transfer kinetics and the effects of various conditions on enzymatic activity .

  • Drug development and inhibitor screening: While more commonly performed with human COX-2 (which is a different protein despite the similar name), similar approaches could be applied to mitochondrial COX2 to identify compounds that modulate its activity.

  • Antibody development: The purified recombinant protein can be used to generate specific antibodies for detection and localization studies.

  • Evolutionary and comparative studies: Recombinant COX2 from different species or with specific mutations can be compared to understand evolutionary adaptations in enzyme function.

What challenges exist in expressing and maintaining functional recombinant COX2, and how can they be overcome?

Producing functional recombinant COX2 presents several technical challenges:

  • Membrane protein expression barriers: As an integral membrane protein, COX2 requires proper insertion into lipid bilayers for native folding. This can be addressed by:

    • Using specialized membrane protein expression systems

    • Co-expression with chaperones

    • Expression as fusion proteins with solubility-enhancing partners

    • Optimization of detergent types and concentrations during extraction

  • Metal incorporation: Functional COX2 requires copper coordination for electron transfer. Strategies include:

    • Supplementation of growth media with copper

    • In vitro reconstitution with metal cofactors

    • Co-expression with copper chaperones

  • Protein stability challenges: COX2 may be prone to aggregation or denaturation during purification. Solutions include:

    • Careful selection of detergents based on solubilization studies like those shown for cytochrome c oxidase

    • Addition of stabilizing agents such as glycerol (typically 50% for storage)

    • Maintaining appropriate buffer conditions (Tris-based buffers at pH 8.0)

    • Avoiding repeated freeze-thaw cycles

  • Assembly requirements: In vivo, COX2 functions as part of a multi-subunit complex. For functional studies, researchers may need to:

    • Reconstitute with other purified subunits

    • Use liposome reconstitution approaches to maintain activity for membrane proteins

    • Develop simplified systems that preserve key functional aspects while reducing complexity

These challenges require systematic optimization of expression and purification protocols tailored to the specific experimental goals.

How can mutagenesis approaches be applied to study structure-function relationships in COX2?

Targeted mutagenesis provides powerful insights into COX2 function:

  • Leader peptide investigations: Studies in Saccharomyces cerevisiae demonstrated that partial deletions, point mutations, and local frameshifts within the leader peptide coding region of COX2 affect translation efficiency . Similar approaches could be applied to V. polyspora COX2 to:

    • Identify regulatory elements within the mRNA sequence

    • Determine the role of specific amino acids in protein targeting and processing

    • Optimize expression levels for recombinant production

  • Functional domain analysis: Site-directed mutagenesis of conserved residues can reveal:

    • Amino acids essential for cytochrome c binding

    • Residues involved in metal coordination

    • Determinants of interaction with other complex subunits

    • Regions important for membrane insertion and stability

  • Evolutionary studies: Creating chimeric constructs between COX2 proteins from different species can identify domains responsible for species-specific functions and interactions.

  • Temperature-sensitive mutations: As demonstrated in studies of other mitochondrial proteins , temperature-sensitive mutations can be valuable for studying conditional phenotypes and protein assembly processes.

  • Suppressor analysis: Testing suppressors of mutations can identify interacting partners or compensatory mechanisms. In S. cerevisiae COX2 studies, mutations that partially block translation were suppressed by nearby sequence substitutions that weakened a predicted stem structure .

These mutagenesis approaches provide mechanistic insights into the structure-function relationships of COX2 proteins.

What is the relationship between COX2 sequence variation and selective pressures in different species?

Evolutionary analysis of COX2 reveals complex selective pressures:

  • Purifying selection vs. positive selection: In Tigriopus californicus, analysis of the ratio of nonsynonymous to synonymous substitution (omega) indicated that the majority of codons in COX2 are under strong purifying selection (omega << 1), while approximately 4% of sites appear to evolve under relaxed selective constraint (omega = 1) .

  • Evidence for positive selection: Branch-site maximum likelihood models identified specific sites that may have experienced positive selection within certain lineages . For example, three sites within central California sequence clades showed evidence of positive selection, consistent with previous studies showing functional and fitness consequences among interpopulation hybrids .

  • Coevolution with interaction partners: The high degree of interaction between COX2 and nuclear-encoded subunits suggests some codons in the COX2 gene are likely under positive selection to compensate for amino acid substitutions in other subunits .

  • Species-specific acceleration: In primates, monkeys and apes have undergone a nearly two-fold increase in the rate of amino acid replacement in COX2 compared to other primates . This accelerated evolution suggests either relaxed constraints or adaptive evolution in certain lineages.

  • Functional consequences: The replacement of specific amino acids can have significant functional impacts. For example, the replacement of glutamate and aspartate at positions 114 and 115 in higher primates affects enzyme kinetics in cross-reactions with cytochromes from other mammals .

These evolutionary patterns reflect the balance between maintaining critical functional properties while adapting to changes in interacting partners and cellular environments.

How can advanced imaging and spectroscopic techniques be applied to study recombinant COX2?

Advanced biophysical techniques provide crucial insights into COX2 structure and function:

  • Cryo-electron microscopy (cryo-EM): This technique can reveal:

    • High-resolution structures of COX2 within the complete cytochrome c oxidase complex

    • Conformational changes during the catalytic cycle

    • Interactions with electron donors and other subunits

  • Advanced spectroscopic techniques:

    • Resonance Raman spectroscopy can characterize the heme and copper centers

    • Electron paramagnetic resonance (EPR) spectroscopy can examine the metal centers involved in electron transfer

    • Time-resolved spectroscopy can track electron transfer events in real-time

  • Single-molecule approaches:

    • Fluorescence resonance energy transfer (FRET) can monitor conformational changes and protein-protein interactions

    • Atomic force microscopy (AFM) can examine COX2 in membrane environments

  • Neutron diffraction: This technique can provide insights into hydrogen positions and proton transfer pathways critical for COX2 function.

  • Mass spectrometry-based approaches:

    • Hydrogen-deuterium exchange mass spectrometry can map protein dynamics and conformational changes

    • Crosslinking mass spectrometry can identify interaction interfaces with other proteins

These advanced techniques, when applied to recombinant V. polyspora COX2, can provide unprecedented insights into its structure, dynamics, and functional mechanisms.

What are the most promising future research directions for V. polyspora COX2?

Future research on Vanderwaltozyma polyspora COX2 holds significant potential in several areas:

  • Comparative mitochondrial genomics: Leveraging the extensive variation in mitochondrial gene order between fungi to understand evolutionary mechanisms and selective pressures.

  • Translation regulation mechanisms: Further investigation of the regulatory elements in the COX2 mRNA that control translation, following the discoveries in S. cerevisiae about the role of the leader peptide coding sequence .

  • Structure-function relationships: Detailed investigation of how specific amino acid residues contribute to electron transfer, protein-protein interactions, and membrane integration.

  • Evolutionary adaptation studies: Examining how COX2 has adapted to different cellular environments and coevolved with its interaction partners across fungal lineages.

  • Systems biology approaches: Integration of COX2 function into broader models of mitochondrial respiration and cellular energy metabolism in different yeast species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.