Recombinant Vanderwaltozyma polyspora Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Functional Insights

COX3 is integral to cytochrome c oxidase activity, interacting with regulatory factors like Rcf1 to modulate enzyme efficiency . Studies in Saccharomyces cerevisiae homologs reveal:

  • Rcf1 Interaction: The conserved Hig-domain and fungi-specific C-terminus of Rcf1 bind COX3 during oxidase assembly, influencing catalytic activity .

  • Energy Demands: COX3-Rcf1 interactions become critical under high-energy conditions, stabilizing proton-pumping dynamics .

Applications in Research

This recombinant protein is optimized for:

ApplicationUse CaseProduct Example (Source)
SDS-PAGE AnalysisPurity verification and molecular weight determinationCreative BioMart RFL33353VF
ELISA/Western BlotAntibody validation and quantificationAviva Systems Biology OPCA109947
Enzyme Activity AssaysInvestigating cytochrome c oxidase kinetics and inhibition mechanismsColorectal Research CF015074VDW

Genomic and Evolutionary Context

Vanderwaltozyma polyspora COX3 (UniProt ID: A6H4Q3) lacks CGN codons in its rps3 gene, correlating with the absence of tRNA Arg (ACG) in its mitochondrial genome . This contrasts with relatives like Saccharomyces cerevisiae, which retain both tRNA Arg (ACG) and CGN codon usage .

Research Limitations

While recombinant COX3 enables in vitro studies, its fungal-specific C-terminal regions complicate direct extrapolation to mammalian systems . Additionally, batch-to-batch variability in post-translational modifications may affect activity assays .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; VapofMp03; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Cytochrome oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
COX3
Target Protein Sequence
MLNYMERSKHQQFPFHLVNPSPWPIVVSFSLLSLALSLGLTMHGYIGEMYLVNLALLVVL GSGVLWFRDIIAEATYLGDHTAAVRKGINIGFLLFVLSEVLIFSALFWSYFHSAMSPDVT LGACWPPVGITAVQPTELPLLNTIILLASGATVTYSHHALIQGNRKNSLSGLLITTWLII IFVICQYIEYTNATFTISDGVYGSVFFAGTGLHFLHMVMLAIMLAVCYWRLRNYHLTNSH HVGYETTIIYLHVLDVIWLFLYIVFYWWGV
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules utilizing 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Vanderwaltozyma polyspora COX3 and its role in mitochondrial function?

Cytochrome c oxidase subunit 3 (COX3) in Vanderwaltozyma polyspora is a mitochondrially-encoded protein that forms an essential component of the cytochrome c oxidase (COX) enzyme complex, which represents the terminal oxidase of the respiratory electron transport chain. COX3 functions as a separate assembly module from the Cox1p subunit, featuring unique compositions of ancillary factors and nuclear-derived subunits . The protein plays a crucial role in maintaining the structural integrity of the COX complex and facilitating electron transfer reactions necessary for cellular respiration.

The expression of COX3 in Vanderwaltozyma polyspora is regulated at both transcriptional and post-transcriptional levels, with evidence suggesting that assembly of the Cox1p module is not contingent on Cox3p presence, though the reverse dependency exists - Cox3p subassemblies are not detected in mutants blocked in Cox1p translation . This asymmetric relationship underscores the sequential assembly process of the COX complex in yeast mitochondria.

How should researchers design expression systems for recombinant Vanderwaltozyma polyspora COX3?

When designing expression systems for recombinant Vanderwaltozyma polyspora COX3, researchers should consider the following methodological approaches:

  • Vector selection and tag optimization: Based on research with related yeast species, C-terminal polyhistidine tags have demonstrated better functionality than N-terminal tags. Studies in Saccharomyces cerevisiae showed that C-terminal polyhistidine tags on Cox3p preserved wild-type growth on glycerol/ethanol media, whereas N-terminal HAC (hemagglutinin-protein C epitope) tags resulted in partial growth defects and approximately twofold reduction in mitochondrial cytochrome oxidase .

  • Host system considerations: Insect cell expression systems such as Sf9 cells have proven effective for expressing membrane-bound proteins like COX3 . These systems provide appropriate post-translational modifications, particularly glycosylation, which is essential for cyclooxygenase activity in COX proteins.

  • Storage and handling protocols: Recombinant proteins should be stored in optimized buffers (such as Tris-based buffer with 50% glycerol) at -20°C for routine use, or at -80°C for extended storage . Researchers should avoid repeated freeze-thaw cycles and prepare working aliquots that can be stored at 4°C for up to one week .

What purification and characterization methods are effective for recombinant Vanderwaltozyma polyspora COX3?

For optimal purification and characterization of recombinant Vanderwaltozyma polyspora COX3, researchers should implement the following methodological approaches:

  • Affinity chromatography: Utilize tag-based purification approaches, such as metal affinity chromatography for His-tagged constructs. When designing purification strategies, researchers should account for the membrane-bound nature of the protein and consider detergent solubilization methods compatible with downstream applications.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique effectively resolves COX3 intermediates and subcomplexes. Based on studies of related yeast species, BN-PAGE can separate distinct assembly intermediates of COX3, such as the C2 (~200 kDa), C3 (~230 kDa), and C4 (~300 kDa) complexes identified in S. cerevisiae .

  • Two-dimensional gel electrophoresis: This approach allows detection of newly translated COX subunits and assessment of their incorporation into supercomplexes. The combination of BN-PAGE with SDS-PAGE provides comprehensive characterization of protein complex composition and stability .

  • Co-immunoprecipitation assays: These assays help identify protein-protein interactions between COX3 and other subunits or assembly factors. For example, studies in S. cerevisiae revealed interactions between Cox3p and Cox4p when mitochondria were purified from strains expressing Cox4p-HAC .

How does horizontal gene transfer and recombination affect COX3 evolution in Vanderwaltozyma polyspora?

Horizontal gene transfer (HGT) and homologous recombination significantly influence COX3 evolution in Vanderwaltozyma polyspora and related yeast species. Extensive analysis of mitochondrial genomes in the Saccharomycetaceae family has revealed several key mechanisms:

  • Intron mobility and transfer: Mitochondrial genes like COX3 frequently undergo intron gain and loss events. Studies have detected significant evidence for recombination in most examined introns, confirmed by multiple recombination-detection methods . These intron transfer events contribute to genetic diversity and can impact protein function.

  • Variable turnover rates: Different regions of COX genes demonstrate varying rates of evolutionary change. Quantitative analysis of intron turnover rates in cox genes reveals that these rates can differ significantly, as demonstrated in Table 1:

IntronMobilityOne Rate ParameterTwo Rate Parameters
Rate (m)ln LGainLossln L
cox1 i1Yes0.5±0.4-6.90.7±1.054.8±25.8-5.3
cox1 i2Yes2.3±1.1-13.21.0±1.424.9±11.7--
  • Chimerism through recombination: Phylogenetic analyses have demonstrated that different segments of COX genes can have distinct evolutionary histories, suggesting recombination events that create chimeric genes . This phenomenon has been particularly well-documented in the cob gene, which shows different phylogenetic relationships at different alignment positions (notably between positions 1051-1142 and the remaining sequence) .

When studying Vanderwaltozyma polyspora COX3 evolution, researchers should employ multiple phylogenetic reconstruction methods and carefully analyze sequence segments separately to detect potential chimerism resulting from recombination events.

What experimental approaches can elucidate the assembly pathway of Vanderwaltozyma polyspora COX3?

To investigate the assembly pathway of Vanderwaltozyma polyspora COX3, researchers should consider these experimental approaches:

  • Pulse-chase labeling with in organello translation: This technique allows tracking of newly synthesized mitochondrial proteins and their incorporation into complexes. Based on studies in S. cerevisiae, researchers can isolate mitochondria and perform labeling with [35S]methionine for 20 minutes, followed by immunoprecipitation of tagged proteins to identify assembly intermediates .

  • Sequential immunoprecipitation experiments: These experiments help establish the order of subunit association during complex assembly. Using strains expressing differentially tagged subunits (such as Cox3p-HAC, Cox4p-HAC, or Cox7p-HAC), researchers can isolate specific subcomplexes and identify their components through subsequent analytical techniques .

  • Supercomplex analysis: The incorporation of COX3 into respiratory supercomplexes can be assessed through BN-PAGE followed by immunoblotting or autoradiography. Studies in S. cerevisiae have identified supercomplexes containing the bc1 complex and COX in 2:2 or 2:1 ratios . The composition and stability of these supercomplexes provide insights into COX3 assembly and function.

  • Genetic complementation assays: These assays can determine the functional importance of specific domains or residues in COX3. Researchers can introduce modified COX3 genes through recombination into mutants where the native gene has been replaced with a selectable marker (such as ARG8m) .

How can researchers investigate the impact of COX3 variants on mitochondrial function in Vanderwaltozyma polyspora?

To assess the functional consequences of COX3 variants in Vanderwaltozyma polyspora, researchers should implement these methodological approaches:

What methods are most effective for studying COX3 interactions with supercomplex assembly factors?

For investigating COX3 interactions with supercomplex assembly factors in Vanderwaltozyma polyspora, the following methodological approaches are recommended:

  • Co-immunoprecipitation with tagged variants: Express tagged versions of COX3 (such as Cox3p-HAC) and use antibody-based purification to isolate protein complexes. Analysis of co-purified proteins can identify interacting partners, as demonstrated in studies of S. cerevisiae where interactions with assembly factors like Rcf1p were detected .

  • Cross-linking mass spectrometry: Apply chemical cross-linking followed by mass spectrometry to capture transient interactions between COX3 and assembly factors. This approach can identify specific contact points between proteins.

  • Two-dimensional gel electrophoresis of labeled mitochondrial translation products: This technique can resolve assembly intermediates containing newly synthesized COX3 and associated factors. Studies in S. cerevisiae have used this approach to identify distinct complexes (C2, C3, and C4) containing Cox3p .

  • Genetic interaction screens: Systematic analysis of genetic interactions between COX3 and candidate assembly factors can reveal functional relationships. Synthetic growth defects or suppressions can indicate proteins involved in the same pathway.

Research in S. cerevisiae has identified that some Cox3p intermediates contain Rcf1p, a protein associated with the supercomplex that stabilizes the interaction between COX and the bc1 complex . Similar factors likely exist in Vanderwaltozyma polyspora and can be identified using these approaches.

What are the optimal storage and handling conditions for recombinant Vanderwaltozyma polyspora COX3?

To maintain the stability and activity of recombinant Vanderwaltozyma polyspora COX3, researchers should adhere to these storage and handling protocols:

  • Buffer composition: Use Tris-based buffers with 50% glycerol, optimized for the specific protein characteristics . The high glycerol concentration helps prevent protein aggregation and protects against freeze-thaw damage.

  • Storage temperature: Store stock preparations at -20°C for routine use, or at -80°C for extended storage periods . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw management: Avoid repeated freezing and thawing of protein preparations, as this can lead to denaturation and loss of activity . Prepare appropriately sized aliquots based on experimental needs.

  • Glycosylation preservation: When working with recombinant COX3, consider that the protein is likely glycosylated, and experimental conditions should preserve these post-translational modifications, which may be essential for function .

How can researchers design effective inhibition assays for recombinant Vanderwaltozyma polyspora COX3?

When designing inhibition assays for recombinant Vanderwaltozyma polyspora COX3, researchers should consider these methodological approaches:

  • Preincubation protocols: Based on studies with COX proteins, preincubate the enzyme with test compounds for 30 minutes at 25°C before initiating the reaction with substrate addition .

  • Substrate concentration optimization: Use multiple substrate concentrations (e.g., 5 μM and 30 μM arachidonic acid) to distinguish competitive from non-competitive inhibition mechanisms .

  • Reaction conditions: Conduct the enzymatic reaction at physiologically relevant temperatures (e.g., 37°C) for a defined period (e.g., 10 minutes) to ensure consistent results .

  • Activity measurement: Quantify enzyme activity using appropriate techniques such as radioimmunoassay (RIA) for reaction products like prostaglandin E2 (PGE2) .

  • Data analysis: Construct inhibition curves from multiple replicates (at least triplicate determinations) and calculate IC50 values using appropriate software such as PRISM .

For comparing inhibition profiles across different COX isoforms or variants, standardize assay conditions and use reference inhibitors with well-characterized properties to validate the experimental system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.