Recombinant Vanderwaltozyma polyspora Cytochrome oxidase assembly protein 3, mitochondrial (COA3)
Description
Introduction to Recombinant COA3
Recombinant COA3 is a full-length, His-tagged protein expressed in E. coli, derived from the yeast species Vanderwaltozyma polyspora (strain DSM 70294) . It is synthesized to enable biochemical and functional studies of cytochrome oxidase assembly, a key process in mitochondrial electron transport chain regulation .
Primary Structure
-
Amino Acid Sequence:
MALEPSRYLDKKTWKMTPAMIRARQPYFKKNMIALGLLLGITTGVYVYTFNLSHKDNDFIDVPIPPIDEKELAVLQKEFNDKKN.
COA3 regulates COX assembly by interacting with Cox1 (cytochrome c oxidase subunit 1) and the translational activator Mss51. Key mechanisms include:
-
Complex Formation: COA3, Cox14, and Mss51 form 250–400 kDa cytochrome oxidase assembly (COA) intermediates, which sequester Mss51 to suppress COX1 mRNA translation .
-
Feedback Regulation: COA3 and Cox14 shift Mss51 from a translation-active to a latent state, preventing excessive Cox1 synthesis and ensuring coordinated assembly .
-
Stability: Deletion of COA3 or COX14 destabilizes Cox1, leading to its rapid degradation .
Expression and Purification
Stability
Research Applications and Implications
-
Mitochondrial Disease Models: Used to study defects in COX assembly linked to neurodegenerative disorders .
-
Cancer Research: Human COA3 homologs (e.g., CCDC56) are implicated in non-small cell lung cancer (NSCLC) progression via mitochondrial fragmentation and metabolic reprogramming .
-
Drug Development: Target for compounds aiming to modulate oxidative phosphorylation or glycolysis in pathological states .
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: vpo:Kpol_1027p21
STRING: 436907.XP_001643304.1
