Recombinant Vanderwaltozyma polyspora Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MIC60; Kpol_282p3; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-531
Protein Length
Full Length of Mature Protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
MIC60
Target Protein Sequence
STANNNGATLIKKRHPIRNFILKTALGATVFYAGGVALSEYNEKFAEYFRTYVPLGDDLV HNYEVYRYGPDSKLGEGISVVGLREMIQEVVYRNPTKFHPEGGEIEIIQEVVPPTRLLTL ELITVDDERMDPKFSSLVKDLNSTIETIINQNIYLTDSQIGYILECYSTLTAAVTEYNQQ LQNNMNLIIKEKTTKAVNELNSEYEKKFTDKESELTGKFIQDFNNFKDQLEQKKANELNT ELRANEQTLLAKHANEVALLSITQVEEFTKIIKEKVDKERDGRLGQLQELDASVTSLSKS VDKMNNALMKNEVITQMITLLSSMKQKLNEAGTTNEGLSLEKEIDRIKLLSSIVPLATSS CKCSSKCKSNCKCSKSCGRKKTLMSVGISELDNAASGKLILSNEQLYNRWNLLEGDFKAA SLLPANPGILGHFTAKMFSLLLFTKRGVSVDGTDLDSVYAKVSENIRLSKLDKALADVVS LKGWPHVVCQGWIDDAKRKLEVEALIDVLDSEVRAL
Uniprot No.

Target Background

Function

Recombinant Vanderwaltozyma polyspora Formation of crista junctions protein 1 (FCJ1) is a component of the MICOS complex, a large protein complex within the mitochondrial inner membrane. This complex plays vital roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating contact site formation with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane and supports protein import through the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its primary function in yeast mitochondria?

Fcj1 (Formation of crista junction protein 1) is an inner mitochondrial membrane protein in yeast that plays a crucial role in the formation and maintenance of crista junctions (CJs). These architectural elements are tubular invaginations of the inner membrane that connect the inner boundary membrane with the cristae membrane . In the absence of Fcj1, mitochondria display severely altered morphology characterized by concentric cristae stacks with few or no crista junctions . The protein is preferentially localized at CJs and functions in an antagonistic manner to subunits e and g of the F₁F₀ ATP synthase to modulate CJ formation . The mammalian ortholog of Fcj1 is known as mitofilin/IMMT .

How does the structure of Fcj1 relate to its function?

Fcj1 contains multiple functional domains that contribute to its role in crista junction formation:

  • An N-terminal mitochondrial targeting sequence followed by a transmembrane domain that anchors the protein to the inner membrane

  • A coiled-coil domain that likely mediates protein-protein interactions

  • A highly conserved C-terminal domain that is essential for Fcj1 function

The transmembrane segment is important for full functionality, although its specific amino acid sequence is not critical. Experiments with modified Fcj1 proteins (Fcj1ᴳ⁵²ᴸ and Fcj1ᴰˡᵈ¹⁻ᵀᴹ) where this segment was altered showed that these variants could fully complement Fcj1 function . In contrast, the C-terminal domain is absolutely required for proper crista junction formation, with deletion of this domain resulting in a severe reduction in CJs (to approximately 4% of control levels) .

Is Fcj1 conserved across yeast species, including Vanderwaltozyma polyspora?

While the search results don't explicitly detail Fcj1 in Vanderwaltozyma polyspora, they do indicate that orthologs of Fcj1 exist across various species. The mammalian ortholog is called mitofilin or IMMT . Most research has been conducted using Saccharomyces cerevisiae as a model organism. Given that V. polyspora is closely related to S. cerevisiae and descended from the same whole-genome duplication event , it is likely that V. polyspora also possesses an Fcj1 ortholog with similar functions, though potentially with species-specific characteristics.

What happens to mitochondrial morphology when Fcj1 is absent?

In the absence of Fcj1, mitochondria display dramatically altered ultrastructure. The most characteristic changes include:

These morphological changes underscore the essential role of Fcj1 in maintaining proper mitochondrial architecture, particularly the formation of crista junctions that connect the inner boundary membrane with the cristae membrane .

How does the C-terminal domain of Fcj1 contribute to crista junction formation and stability?

The C-terminal domain of Fcj1 is the most conserved region of the protein and plays multiple critical roles in crista junction formation:

  • It mediates interaction with the full-length Fcj1 protein, suggesting a role in oligomer formation

  • It interacts with Tob55 of the translocase of outer membrane β-barrel proteins (TOB/SAM) complex

  • It is essential for the genetic interaction of Fcj1 with subunit e of the F₁F₀ ATP synthase

When this domain is deleted (as in Fcj1¹⁻⁴⁷²), the number of crista junctions per mitochondrial section is dramatically reduced to approximately 9% of control levels . Additionally, mitochondria display irregular, stacked cristae architecture. The following table illustrates the quantitative impact of various Fcj1 modifications on crista junction formation:

StrainRelative number of CJs per mitochondrial section (%)
Δfcj1/Fcj1ᴰᴸᴰ¹⁻ᵀᴹ68
Δfcj1/Fcj1ᴳ⁵²ᴸ124
Δfcj1/Fcj1ᶜʸᵗ ᵇ²46
Δfcj1/Fcj1ᐩ¹⁶⁶⁻³⁴²ᴴⁱˢ4
Δfcj1/Fcj1¹⁻⁴⁷²9

This data demonstrates that the C-terminal domain is critical for establishing the normal complement of crista junctions .

What is the molecular mechanism by which Fcj1 interacts with the TOB/SAM complex, and what are the functional implications of this interaction?

The C-terminal domain of Fcj1 physically interacts with Tob55, a component of the TOB/SAM complex that is responsible for the insertion of β-barrel proteins into the outer mitochondrial membrane. This interaction appears to be crucial for positioning crista junctions close to the outer membrane .

The functional implications of this interaction include:

  • Stabilization of crista junctions in close proximity to the outer membrane

  • Physical anchoring of CJs to the outer membrane via the TOB/SAM complex

  • Proper positioning of CJs at sites where cristae meet the inner boundary membrane

Down-regulation of the TOB/SAM complex leads to altered cristae morphology and a moderate reduction in the number of crista junctions, further supporting the functional significance of this interaction .

How does Fcj1 functionally interact with the F₁F₀ ATP synthase to regulate crista architecture?

Fcj1 modulates crista junction formation in an antagonistic manner to subunits e and g of the F₁F₀ ATP synthase . The cristae structure depends on the oligomerization state of the F₁F₀ ATP synthase, which is influenced by both Fcj1 and subunits e and g .

When variants of Fcj1 lacking the C-terminal domain were expressed in yeast cells lacking subunit e of the F₁F₀ ATP synthase (Δsu e), they failed to exert the dominant-negative effect on growth observed with wild-type Fcj1 . This indicates that the C-terminal domain of Fcj1 is required for the genetic interaction with subunit e, providing further evidence for the functional importance of this domain.

The molecular details of how Fcj1 influences ATP synthase oligomerization remain to be fully elucidated, but the data suggest a complex interplay between these proteins in determining cristae architecture.

What experimental approaches can be used to study the dynamics of crista junction formation in living cells?

Several experimental approaches can be employed to study crista junction dynamics:

What methods can be used to study protein-protein interactions involving Fcj1?

Several complementary approaches can be employed to investigate protein-protein interactions involving Fcj1:

  • Yeast two-hybrid assays: This system can be used to screen for potential interaction partners of Fcj1 or to test specific interactions between Fcj1 domains and other proteins.

  • Co-immunoprecipitation: Antibodies against Fcj1 or its interaction partners can be used to pull down protein complexes from mitochondrial extracts, followed by Western blotting to identify co-precipitated proteins.

  • Protein cross-linking: Chemical cross-linking can be used to stabilize transient protein-protein interactions before extraction and analysis by mass spectrometry.

  • Blue native PAGE: This technique allows separation of native protein complexes and can be used to identify stable protein assemblies containing Fcj1.

  • Bimolecular fluorescence complementation (BiFC): This approach involves expressing fragments of a fluorescent protein fused to potential interaction partners. If the proteins interact, the fluorescent protein fragments are brought together, resulting in fluorescence that can be detected by microscopy.

How can recombinant Fcj1 proteins be produced and purified for structural and functional studies?

Production of recombinant Fcj1 proteins typically involves the following steps:

  • Cloning: The gene encoding Fcj1 or specific domains can be amplified by PCR and cloned into appropriate expression vectors, such as the low-copy-number yeast shuttle vector pRS315 used for complementation studies .

  • Expression systems: Depending on the experimental goals, different expression systems can be used:

    • Yeast expression systems for functional studies (as demonstrated for various Fcj1 variants )

    • Bacterial expression systems (E. coli) for high-yield production of Fcj1 domains for structural studies

    • Insect cell expression systems for production of full-length or complex eukaryotic proteins

  • Purification strategies:

    • Affinity tags (His, GST, etc.) can be added to facilitate purification

    • Size exclusion chromatography can be used to separate monomeric from oligomeric forms

    • Ion exchange chromatography can be employed as an additional purification step

  • Verification of protein integrity:

    • SDS-PAGE and Western blotting to confirm protein expression and purity

    • Mass spectrometry to verify protein identity

    • Circular dichroism spectroscopy to assess secondary structure

What genetic approaches can be used to study Fcj1 function in yeast models?

Several genetic approaches have been successfully applied to investigate Fcj1 function:

  • Gene knockout and complementation: The complete deletion of FCJ1 (Δfcj1) produces a clear phenotype of altered mitochondrial morphology. This strain can then be complemented with various FCJ1 constructs to assess their functionality .

  • Domain swapping and mutagenesis: Specific domains of Fcj1 can be replaced with corresponding domains from other proteins or subjected to site-directed mutagenesis. For example, researchers replaced the transmembrane domain of Fcj1 with that from Dld1 (Fcj1ᴰˡᵈ¹⁻ᵀᴹ) or introduced point mutations (Fcj1ᴳ⁵²ᴸ) to assess the importance of this domain .

  • Expression of truncated proteins: Truncated versions of Fcj1 lacking specific domains (e.g., Fcj1ᐩ¹⁶⁶⁻³⁴², Fcj1¹⁻⁴⁷²) can be expressed to determine the functional importance of these domains .

  • Promoter swapping: The native promoter of FCJ1 can be replaced with regulatable promoters (e.g., the constitutive ADH promoter) to control expression levels .

  • Cross-species complementation: FCJ1 genes from different yeast species can be expressed in S. cerevisiae to assess functional conservation and species-specific differences .

How does Fcj1 in Vanderwaltozyma polyspora compare to its orthologs in other yeast species?

While the search results do not specifically compare Fcj1 in V. polyspora with orthologs in other yeast species, they do provide information about another protein system in V. polyspora that may serve as a model for understanding possible evolutionary patterns.

In the case of alanyl-tRNA synthetase (AlaRS), V. polyspora contains two distinct nuclear genes (VpALA1 and VpALA2) that encode the cytoplasmic and mitochondrial forms, respectively . This differs from all other yeast species studied, including S. cerevisiae, which possess a single nuclear gene encoding both forms of AlaRS .

What can be learned from studying Fcj1 in different yeast models?

Studying Fcj1 in different yeast models can provide valuable insights into:

  • Evolutionary conservation: Determining which domains and functions of Fcj1 are conserved across species helps identify core mechanisms of crista junction formation.

  • Species-specific adaptations: Differences in Fcj1 structure or regulation between species may reflect adaptations to specific metabolic requirements or environmental niches.

  • Functional redundancy: Some species might have developed redundant or complementary mechanisms for crista junction formation, providing insights into alternative pathways.

  • Protein-protein interaction networks: The composition of protein complexes containing Fcj1 may vary between species, revealing the flexibility and constraints of these interaction networks.

  • Regulatory mechanisms: Differences in the regulation of Fcj1 expression or activity between species can highlight important control points in mitochondrial morphology.

What are the unanswered questions regarding the mechanism of Fcj1 function in crista junction formation?

Several key questions remain regarding Fcj1 function:

  • What is the precise molecular mechanism by which Fcj1 promotes the formation of the highly curved membrane structure at crista junctions?

  • How does Fcj1 coordinate with other proteins of the MICOS/MINOS/MitOS complex to establish and maintain crista junctions?

  • What is the regulatory mechanism controlling Fcj1 activity and localization in response to changes in cellular metabolism or stress?

  • What is the three-dimensional structure of Fcj1, particularly its C-terminal domain, and how does this structure contribute to its function?

  • How does the interaction between Fcj1 and the TOB/SAM complex mechanistically contribute to positioning crista junctions at the outer membrane?

How might advanced imaging techniques contribute to our understanding of Fcj1 dynamics and crista junction formation?

Advanced imaging techniques could significantly enhance our understanding of Fcj1 dynamics and crista junction formation:

  • Super-resolution microscopy (STED, PALM, STORM): These techniques could overcome the diffraction limit of conventional light microscopy, allowing visualization of Fcj1 distribution and dynamics at nanometer resolution in living cells.

  • Cryo-electron tomography: This technique could provide high-resolution three-dimensional views of mitochondrial ultrastructure, including crista junctions, in a near-native state without chemical fixation artifacts.

  • Correlative light and electron microscopy (CLEM): This approach could combine the advantages of fluorescence microscopy (specific labeling, dynamics) with the high resolution of electron microscopy to track Fcj1 localization and function.

  • Live-cell imaging with photoactivatable fluorescent proteins: This method could allow tracking of newly synthesized Fcj1 proteins to understand their assembly into existing structures.

  • FRET (Förster Resonance Energy Transfer): This technique could be used to study protein-protein interactions involving Fcj1 in living cells, providing insights into the dynamic assembly of crista junction complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.