Recombinant Vanderwaltozyma polyspora Golgi apparatus membrane protein TVP18 (TVP18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TVP18; Kpol_348p9; Golgi apparatus membrane protein TVP18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Target Names
TVP18
Target Protein Sequence
MALSIKQFVNFAGFVKDLKSFNFSVYAQYFGYINIIVCMALGIANLFHVNAVIAFGIVAI VQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRCIFYTLMAIVQWCSLALMVTSLI VVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDFPHDAVVREML
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP18 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TVP18 and what is its role in cellular function?

TVP18 (Tlg2-compartment Vesicle Protein 18) is a transmembrane protein localized primarily in the Golgi apparatus. It belongs to a family of novel membrane proteins (including Tvp38, Tvp23, and Tvp15) that were initially identified in Tlg2-containing membranes through proteomic analysis of immunoisolated Golgi subcompartments in Saccharomyces cerevisiae . TVP18 is part of an interactive protein network with Yip1-family proteins (specifically Yip4 and Yip5) that collectively maintain and regulate the function of late Golgi and endosomal compartments . Although TVP18 is nonessential for growth under standard laboratory conditions, its conserved sequence across species from yeast to humans suggests important evolutionary roles in Golgi function and vesicular trafficking .

What are the recommended expression systems for recombinant TVP18 production?

  • Membrane proteins like TVP18 may present challenges for proper folding in prokaryotic systems

  • Eukaryotic expression systems (including yeast) might provide better post-translational modifications

  • Cell-free systems can be considered for difficult-to-express membrane proteins

The choice of expression system should be guided by the specific experimental requirements, including the need for post-translational modifications and protein yield requirements.

What are the optimal conditions for storage and reconstitution of recombinant TVP18 protein?

Based on established protocols for recombinant TVP18, the following storage and reconstitution conditions are recommended:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage

  • Aliquot and store at -20°C/-80°C

The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

How can researchers effectively isolate and purify native TVP18 from yeast cells?

Isolation of native TVP18 from yeast cells can be achieved through immunoisolation techniques similar to those used in characterizing Golgi subcompartments:

Recommended protocol:

  • Prepare yeast cell lysates under conditions that preserve membrane integrity

  • Perform differential centrifugation to obtain membrane fractions

  • Use affinity purification with antibodies specific to TVP18 coupled to Pansorbin cells or other solid supports

  • Solubilize bound vesicles in appropriate detergent mixtures (e.g., 1% Triton X-114)

  • Further separate membrane proteins using Triton X-114 phase separation:

    • Solubilize vesicles in buffer containing 1% Triton X-114

    • Incubate on ice for 15 min

    • Transfer to 30°C for 5 min

    • Centrifuge at 5,000 × g for 5 min at room temperature

    • Process the detergent phase by adding buffer with 0.5% Triton X-114

This approach allows for effective isolation of TVP18 along with its interacting partners while maintaining native protein-protein interactions.

What methods are most effective for detecting TVP18 subcellular localization?

To accurately determine TVP18 subcellular localization, researchers should consider complementary approaches:

  • Immunofluorescence microscopy:

    • Tag TVP18 with epitope tags (e.g., HA tag) for detection with commercial antibodies

    • Co-stain with markers for different Golgi subcompartments (e.g., myc-tagged tSNAREs)

    • Use confocal microscopy for high-resolution localization

  • Subcellular fractionation:

    • Perform gradient centrifugation to separate cellular compartments

    • Identify TVP18-containing fractions via immunoblotting

    • Compare distribution with known Golgi and endosomal markers

  • Immunoelectron microscopy:

    • For ultrastructural localization at the nanometer scale

    • Use gold-conjugated antibodies against TVP18 or its epitope tags

    • Allows precise localization within Golgi cisternae and associated vesicles

The combination of these approaches provides robust evidence for the subcellular distribution of TVP18 within the Golgi network and potentially other compartments.

What is known about the protein interaction network involving TVP18?

TVP18 functions within a complex protein interaction network primarily centered around Golgi trafficking pathways:

Key interaction partners:

  • Yip1-family proteins: TVP18 interacts with Yip4 and Yip5, which are essential for effective maintenance and function of late Golgi/endosomal compartments

  • Other Tvp proteins: TVP18 likely functions in concert with Tvp15, Tvp23, and Tvp38 in Golgi trafficking

  • Tlg2-containing compartments: TVP18 localizes to these compartments, suggesting functional relationships with SNARE proteins involved in vesicle fusion

These interactions collectively suggest that TVP18 participates in a network responsible for maintaining Golgi structure and regulating vesicular trafficking between the Golgi and endosomal compartments.

How do mutations in TVP18 affect cellular function and viability?

While TVP18 and other Tvp proteins are nonessential for growth under standard laboratory conditions , mutation studies reveal important insights:

  • Individual disruption of TVP18 does not significantly impact cell viability or growth rates under normal conditions

  • The nonessential nature of TVP18 suggests functional redundancy with other trafficking proteins

  • Synthetic genetic interactions may reveal conditional requirements for TVP18:

    • By analogy to TVP23, which shows synthetic aggravation with ypt6 or ric1 null mutations

    • Combined mutations in multiple Tvp proteins may reveal more pronounced phenotypes

To fully understand TVP18 function, researchers should consider conditional phenotypes that may only become apparent under specific stress conditions or in combination with mutations in interacting partners.

What roles does TVP18 play in protein glycosylation and secretory pathway function?

The localization of TVP18 in the Golgi apparatus suggests potential roles in protein glycosylation and secretory pathway function:

  • Glycosylation processing: The Golgi is the primary site for protein glycosylation, and TVP18 may influence the trafficking or localization of glycosylation enzymes

  • Cargo sorting: TVP18 may participate in the sorting of cargo proteins destined for different cellular compartments

  • Vesicle formation: As a membrane protein interacting with Yip family members, TVP18 likely contributes to vesicle formation or trafficking

Based on studies of the homologous TVP23B protein in higher organisms, these Tvp family proteins appear to be critical for proper Golgi proteome maintenance and glycosylation enzyme localization . Disruption of this system can lead to defects in protein modification and secretion.

How can CRISPR-Cas9 genome editing be used to study TVP18 function in various yeast species?

CRISPR-Cas9 genome editing offers powerful approaches for investigating TVP18 function:

Recommended experimental design:

  • Gene knockout strategy:

    • Design guide RNAs targeting the TVP18 coding sequence

    • Include repair templates with selectable markers for efficient screening

    • Verify knockouts by sequencing and protein expression analysis

  • Tagging strategy:

    • Insert epitope or fluorescent protein tags at the C-terminus to preserve protein function

    • Ensure the tag does not interfere with transmembrane domains or interaction surfaces

    • Validate proper localization and function of tagged protein

  • Base editing applications:

    • Introduce specific point mutations to assess the importance of conserved residues

    • Create conditional alleles to study essential functions

  • Multiple gene editing:

    • Target TVP18 together with genes encoding interacting partners (Yip4, Yip5, other Tvp proteins)

    • Create double or triple mutants to overcome functional redundancy

This approach allows for precise genetic manipulation and functional characterization of TVP18 in its native context.

What proteomics approaches are most suitable for identifying the interactome of TVP18?

Comprehensive characterization of the TVP18 interactome requires sophisticated proteomics approaches:

Recommended methodologies:

  • Proximity-based labeling:

    • Fuse TVP18 with BioID or APEX2 enzymes

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins under stringent conditions

    • Identify interaction candidates by mass spectrometry

  • Immunoprecipitation coupled with mass spectrometry (IP-MS):

    • Use epitope-tagged TVP18 for efficient pulldown

    • Perform crosslinking to capture transient interactions

    • Implement SILAC or TMT labeling for quantitative comparison

    • Apply stringent statistical analysis to differentiate specific interactions from background

  • Membrane yeast two-hybrid systems:

    • Specially designed for membrane proteins like TVP18

    • Allows screening of protein-protein interactions in membrane environments

Example workflow for TVP18 interactome analysis:

StepMethodDetails
1Expression of tagged TVP18N-terminal or C-terminal epitope tag (HA, FLAG)
2Membrane fraction isolationDifferential centrifugation and sucrose gradient
3Protein complex isolationImmunoprecipitation with crosslinking
4Sample preparationIn-gel or on-bead digestion with trypsin
5Mass spectrometryLC-MS/MS analysis with high resolution
6Data analysisComparison to control samples, statistical filtering
7ValidationCo-immunoprecipitation, proximity ligation assays

How does TVP18 function compare between Vanderwaltozyma polyspora and other yeast species like Saccharomyces cerevisiae?

Comparative analysis of TVP18 function across yeast species provides evolutionary insights:

  • Sequence conservation analysis:

    • TVP18 shows conservation across diverse yeast species, suggesting fundamental roles

    • Key functional domains and transmembrane regions show higher conservation

    • Species-specific variations may indicate specialized adaptations

  • Functional complementation studies:

    • Test if V. polyspora TVP18 can complement S. cerevisiae tvp18Δ phenotypes in sensitized backgrounds

    • Construct chimeric proteins to identify species-specific functional domains

    • Assess complementation under various stress conditions

  • Evolutionary considerations:

    • Vanderwaltozyma polyspora diverged from S. cerevisiae before the whole-genome duplication event

    • This evolutionary position may provide insights into the ancestral functions of TVP18

    • Comparison with methylotrophic yeasts like Komagataella phaffii may reveal specialized adaptations

By analogy with studies on the Arabidopsis ECHIDNA protein, which can complement yeast tvp23Δ and ypt6Δ mutant phenotypes, TVP18 likely has evolutionarily conserved functions in Golgi trafficking and membrane organization that extend across diverse eukaryotic lineages .

What are common challenges in working with recombinant TVP18 and how can they be addressed?

Researchers working with recombinant TVP18 should anticipate several challenges:

Challenge 1: Protein solubility and stability

  • Solution: Use mild detergents (DDM, LMNG, or Triton X-114) for solubilization

  • Recommendation: Include 6% trehalose in storage buffers to enhance stability

  • Alternative approach: Consider nanodiscs or amphipols for maintaining native membrane environment

Challenge 2: Proper folding during recombinant expression

  • Solution: Lower expression temperature (16-20°C) to slow folding and prevent aggregation

  • Recommendation: Test multiple expression hosts (E. coli, yeast, insect cells)

  • Alternative approach: Use fusion partners (MBP, SUMO) to enhance solubility

Challenge 3: Low expression yields

  • Solution: Optimize codon usage for the expression host

  • Recommendation: Test different promoters and induction conditions

  • Alternative approach: Consider cell-free expression systems

Challenge 4: Functional validation

  • Solution: Develop robust activity assays based on protein interactions

  • Recommendation: Use complementation of yeast mutants as functional readout

  • Alternative approach: Assess membrane incorporation using fluorescence-based approaches

How can researchers effectively design experiments to determine the specific function of TVP18 in Golgi trafficking?

To elucidate TVP18's specific function in Golgi trafficking, consider these experimental approaches:

  • Cargo trafficking assays:

    • Express model cargo proteins (e.g., GFP-tagged secretory proteins)

    • Compare trafficking kinetics in wild-type vs. tvp18Δ cells

    • Use temperature-sensitive blocks to examine specific trafficking steps

  • Live-cell imaging approaches:

    • Generate fluorescently tagged TVP18 constructs

    • Perform live-cell imaging with high temporal resolution

    • Track colocalization with known trafficking markers (Rabs, SNAREs)

  • In vitro reconstitution:

    • Purify TVP18-containing membranes

    • Establish in vitro budding or fusion assays

    • Test the requirement for TVP18 in specific trafficking events

  • Integrative approach:

    • Combine genetic, biochemical, and imaging methods

    • Correlate phenotypes with molecular mechanisms

    • Build testable models of TVP18 function

Decision tree for experimental design:

QuestionMethodExpected Outcome
Where exactly does TVP18 localize?Immunoelectron microscopyPrecise localization within Golgi cisternae
What proteins interact with TVP18?BioID proximity labeling + MSComprehensive interactome in native context
When is TVP18 required?Conditional depletion systemsTemporal requirement in trafficking pathways
How does TVP18 affect trafficking?Cargo sorting assaysSpecific cargo classes affected by TVP18
What is the structural basis for TVP18 function?Cryo-EM of TVP18 complexesMolecular mechanism of TVP18 action

What considerations should researchers keep in mind when interpreting data from TVP18 functional studies?

When interpreting data from TVP18 functional studies, researchers should consider:

  • Functional redundancy:

    • TVP18 belongs to a family of related proteins (Tvp15, Tvp23, Tvp38)

    • Single gene deletions may show mild phenotypes due to compensation

    • Consider creating multiple deletion strains to overcome redundancy

  • Condition-dependent phenotypes:

    • Phenotypes may only manifest under specific stress conditions

    • Test multiple growth conditions (temperature, pH, carbon source)

    • Consider specific trafficking stresses (protein overexpression, drug treatments)

  • Interaction network context:

    • TVP18 functions within a complex network including Yip proteins

    • Interpret TVP18 phenotypes in the context of this network

    • Consider synthetic genetic interactions when designing experiments

  • Evolutionary conservation:

    • Compare results with homologs in other species

    • Conserved functions likely represent core activities

    • Species-specific effects may reflect specialized adaptations

  • Technical limitations:

    • Epitope tagging may affect protein function

    • Overexpression may cause artifacts

    • Detergent solubilization may disrupt native interactions

By carefully considering these factors, researchers can develop more robust interpretations of TVP18 functional data and place findings in the broader context of Golgi trafficking mechanisms.

What are the most promising future research directions for understanding TVP18 function?

Several promising research directions could significantly advance our understanding of TVP18:

  • Structural biology approaches:

    • Determine the high-resolution structure of TVP18 using cryo-EM or X-ray crystallography

    • Elucidate how TVP18 interacts with membrane lipids and protein partners

    • Use structure-guided mutagenesis to define functional domains

  • Systems biology integration:

    • Place TVP18 within the broader context of Golgi trafficking networks

    • Apply network analysis to identify key hubs and interactions

    • Develop predictive models of TVP18 function in trafficking pathways

  • Translational research potential:

    • Investigate whether TVP18 homologs in higher eukaryotes have conserved functions

    • Explore potential connections to human disease, based on findings that TVP23B regulates host-microbe interactions

    • Develop tools to modulate TVP18 function for biotechnological applications

  • Evolutionary perspectives:

    • Comparative analysis across diverse yeast species and other eukaryotes

    • Reconstruction of ancestral TVP18 sequences and functions

    • Understanding how TVP18 function has been adapted across evolution

These research directions would significantly enhance our understanding of this conserved but understudied component of the eukaryotic trafficking machinery.

How might understanding TVP18 function contribute to broader knowledge in cell biology and biotechnology?

Insights into TVP18 function have significant implications:

  • Fundamental cell biology:

    • Enhanced understanding of Golgi organization and function

    • Insights into the evolutionary conservation of trafficking mechanisms

    • New perspectives on organelle biogenesis and maintenance

  • Biotechnology applications:

    • Improved protein secretion systems for recombinant protein production

    • Enhanced glycoprotein production and quality control

    • Potential targets for modulating secretory pathway efficiency in industrial yeast strains

  • Biomedical relevance:

    • By analogy with TVP23B, which regulates host-microbe interactions , TVP18 homologs may play important roles in human health

    • Potential connections to disorders of glycosylation or protein trafficking

    • Possible targets for therapeutic intervention in trafficking-related diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.